SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007939 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007939
Domain Number 1 Region: 99-476
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.35e-42
Family Amylase, catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 479-565
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000248
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007939   Gene: ENSECAG00000009822   Transcript: ENSECAT00000010302
Sequence length 570
Comment pep:known chromosome:EquCab2:12:23076780:23097881:1 gene:ENSECAG00000009822 transcript:ENSECAT00000010302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEPPEPSTGVDSVPRQPPSAHSGPDAQAPSAGGASGTMSQDTEVDMKEVELNEMEPEK
QPMNAASGAAVAVVAAGGAEKNGLVKIKVADDEAEDAAKFTGLSKEELLKVAGSRGWVRT
RWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQSWWHKGALYRIGDLQAFQGRDAGDL
AGLKGRLDYLSTLKVKGIVLGPIHENQEDDVAGTNLEQIHPALGSKEDFDSLLQSAKKKS
IRVILDLTPNYRGQNPWFLPDEITTVATKVEDALKFWMQAGVDGFQFRDVGNLTNASSFL
AKWQDMTKNISEDRLLIAGTESSDLHQIRSLLESTKDLLLTSSYLSNPSFTGKHVEFLVT
QYLNTTGSRWCSWSLSQTGLLTSFVPAQLLRLYQLLLFTLPGTPVFSYGDEIGLEAAVPP
GQPLKAPVMLWDESSFPNTSRSVSSSKTVKAQSQDPGSLLSLFRRLSDQRSKERSLLHGD
FHILSSGPDLFSYVRQWDQNERFLVVLNFGNVGQPAKLGTSSLPTSTSLPARVDLMLSTQ
PGRKESASVELEHLTLEPHEGLLLRFPYVA
Download sequence
Identical sequences F7B906
ENSECAP00000007939 ENSECAP00000007939 9796.ENSECAP00000007939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]