SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008032 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008032
Domain Number 1 Region: 983-1277
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-80
Family Protein kinases, catalytic subunit 0.0000000000703
Further Details:      
 
Domain Number 2 Region: 320-486
Classification Level Classification E-value
Superfamily L domain-like 1.33e-52
Family L domain 0.0000000856
Further Details:      
 
Domain Number 3 Region: 20-181
Classification Level Classification E-value
Superfamily L domain-like 1.81e-43
Family L domain 0.000000108
Further Details:      
 
Domain Number 4 Region: 485-605
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-34
Family Fibronectin type III 0.000000253
Further Details:      
 
Domain Number 5 Region: 789-931
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-23
Family Fibronectin type III 0.00000279
Further Details:      
 
Domain Number 6 Region: 609-689,795-819
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-19
Family Fibronectin type III 0.00000323
Further Details:      
 
Domain Number 7 Region: 221-327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.000000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008032   Gene: ENSECAG00000010127   Transcript: ENSECAT00000010416
Sequence length 1369
Comment pep:known chromosome:EquCab2:7:4882687:4958968:1 gene:ENSECAG00000010127 transcript:ENSECAT00000010416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIAVAALLQGLLAALLQPREVCPGMDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDF
RDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGL
YNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGK
TNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTADGLCCHSECLGNCSEPDDPTKCV
ACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIP
ECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRG
GNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQ
NLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQA
SCENELLTFSHIRTSSDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGS
NSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDII
YVQTNATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQEEDSELYELDY
CLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQILKELEESSFRKTFE
DYLHNVVFVPRSGVFSVSYSCYRPSRKRRALADVGNVTVAVPTVPGFPNTSSTSTPTSSE
ERRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYVSARTMPEAKADDI
VGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRL
RGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIG
SIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGS
FGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVV
SKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMVQMAAEIADGMAYLNAK
KFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVF
TTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCW
QFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSS
HSQREEAGGRDAGSSLGLKRNYEEHIPYTHMNGGKKNGRILTLPRSNPS
Download sequence
Identical sequences F6R9D2
ENSECAP00000008032 9796.ENSECAP00000022825 ENSECAP00000022825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]