SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008048 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008048
Domain Number 1 Region: 841-1118
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-72
Family Protein kinases, catalytic subunit 0.00000423
Further Details:      
 
Domain Number 2 Region: 523-813
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-49
Family Protein kinases, catalytic subunit 0.0000587
Further Details:      
 
Domain Number 3 Region: 370-499
Classification Level Classification E-value
Superfamily SH2 domain 1.71e-19
Family SH2 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 278-385
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 140-260
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000977
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008048   Gene: ENSECAG00000009119   Transcript: ENSECAT00000010434
Sequence length 1131
Comment pep:known chromosome:EquCab2:23:26471560:26605781:1 gene:ENSECAG00000009119 transcript:ENSECAT00000010434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMACLTMAEMEGTSVSVHQNGDIPGNANSVKQVDPVLQVYLYHSLEKAEGDYLKFPTGE
YVAEEICVAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESARHSVLYRIRFYFP
YWYCNGSNRTYRHGISRGAEAPLLDDFVMSYLFAQWRHDFLHGWVKVPVTHETQEECLGM
AVLDMMRIAKEKDQTPLTIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQFS
HCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSRG
KHKESETLTEQNLQLYCDFPDIIDVNIKQAHQEGSNESRIVTIHKQDGKTLEIELSSLRE
ALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPISMDFAISKLKKAGNQTG
LYVLRCSPKDFNKYFLTFAVERENVIEHKHCLITKNENGEYNLSGTKKNFSSLKDLLNCY
QMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGVSEVPTSPTLQRHNNVNQMVFHKIR
NEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKSHRNYSESFFEAASMM
SQLSHKYLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAM
HFLEEKTLIHGNVCAKNILLTREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPP
ECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELA
NLINSCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDP
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEI
LKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQIC
KGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWY
APESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIEL
LKNNGRLPKPDGCPDEIYVIMTQCWNNNVNQRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences F6RE38
ENSECAP00000008048 XP_001492713.1.31192 XP_014716209.1.49734 XP_014716210.1.49734 9796.ENSECAP00000008048 ENSECAP00000008048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]