SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008064 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008064
Domain Number 1 Region: 21-228
Classification Level Classification E-value
Superfamily L domain-like 1.78e-39
Family Ngr ectodomain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008064   Gene: ENSECAG00000010195   Transcript: ENSECAT00000010451
Sequence length 289
Comment pep:known chromosome:EquCab2:2:38993506:39030468:1 gene:ENSECAG00000010195 transcript:ENSECAT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGAAVALRLCSLLLLLGPGHACPAGCTCTDPHTVDCRDRGLPSVPDPFPLDVRKLLVAG
NRIQHIPQDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLAFLDLSYNNLTHLGAGAFR
SAGRLLKLSLANNNLAGVHEAAFETLESLQVLELNDNNLRSLNVAALAVLPALRTLRLDG
NPWLCDCDFAHLFSWIQENASRQPRSLDEIQCSLPVENRRVFLHELSEASFSECKFSLSL
TDLFIIIFSGVAVSIAAIISSFFLATVVQCFQRCTPNKDPEDEEDDEED
Download sequence
Identical sequences F6R654
ENSECAP00000008064 9796.ENSECAP00000008064 ENSECAP00000008064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]