SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008174 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008174
Domain Number 1 Region: 36-508
Classification Level Classification E-value
Superfamily Sema domain 8.63e-175
Family Sema domain 0.0000000000000994
Further Details:      
 
Domain Number 2 Region: 511-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.00017
Further Details:      
 
Domain Number 3 Region: 570-660
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000313
Family I set domains 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008174   Gene: ENSECAG00000010128   Transcript: ENSECAT00000010574
Sequence length 870
Comment pep:known chromosome:EquCab2:23:52979551:53001006:1 gene:ENSECAG00000010128 transcript:ENSECAT00000010574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPPLRRLLRRMWLPVGGLLATLAVVVGTAVAFAPSPRITWEHREVQLMQFHQPGIFNYSA
LLLSEDKDTLYVGAREAVFALNALNISQKQHEAYWRASEDKKAKCAEKGKSKQTECLNYI
RVLQPLSATALYVCGTNAFQPTCDHLDLTSFQFLGRNEDGKGRCPFDPAQSYTSVMVDGE
LYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFSDVIRESTDGAEGEDDRVY
FFFTEVSVEYEFIFKLMIPRVARVCKGDLGGLRTLQKKWTSFLKARLICSRPESNLIFNV
LQDIFVLRSPDLKEPVFYGVFTPQLNNMGLSAVCAYNLSTAEAVFSRGKYMQSATVEQSH
TKWVSYNGAVPTPRPGACINREARAANFSSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPK
LVISDVNYTQIVVDRTQALDGAVYDVMFIGTDRGALHKAVSLKSGVHIIEETQLFPDLKP
VQTLLLSSKKGRRFVYAGSSSGVVQAPLAFCGELHTCVDCVLARDPYCAWSPATAACVAL
PETDSPRRDLVQEMSGDTSVCPDKIKESYRQHFFKHGDTAELKCSQKSNLARVVWKFQNS
GLKAESPKYGLVGRKNLLIFNLSEGDSGVYRCLSEERVRDKTVLQVMAKHVLEVKVVPRT
PVPFTSPAVRTEGGRITPKVSAGPTQGSSPQTPAVRATTPRAIIPSSSAVPTSLSRKPKT
VSSVVSEVHSEKTVYLKSGDNRLLMSLFVFFFVLCLCLFAYNCYKGYLPGQCLKFRSAVL
LAKKQPVSDLSDCEPSAKETLVEQGSFSQQNGGQPKPALDTGYETEQDTMASRLPTDRED
SQRIDDLPVRDRPFDVKCELKFADSDADGD
Download sequence
Identical sequences F6PPV8
ENSECAP00000008174 9796.ENSECAP00000008174 ENSECAP00000008174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]