SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008220 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008220
Domain Number 1 Region: 795-903
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 3-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 279-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 240-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000126
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 130-276
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000154
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 654-791
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000334
Family Growth factor receptor domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008220   Gene: ENSECAG00000010035   Transcript: ENSECAT00000010627
Sequence length 981
Comment pep:known chromosome:EquCab2:7:78363650:78421344:-1 gene:ENSECAG00000010035 transcript:ENSECAT00000010627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DECAQGLDDCHTNALCQNTLTSYKCSCKPGYQGEGRQCEDIDECENELNGGCVHDCWNIP
GNYRCTCFDGFMLAHDGHNCLDVDECLDNNGGCQHTCVNVMGSYECRCKEGFFLSDNQHT
CIHRSEEGLSCMNTNHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQH
SCEDTAEGPECSCHPQYKMHADGRSCLEPEDPALEVTESNATSVADGDKRVKRRLLMETC
AVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGSFD
CSCRKGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFTCACNKGYTLYGFTHCGDTNE
CSINNGGCQQVCVNTVGSYECQCHSTYKLHWNKKDCVEKGVLPTSVSPHVSLHCGKSGGG
ERCFLRCHSGIHLSSGLQEAYSVTCGSSSPLRSKQQKSNDSAFGDVATVRTSVTFKLNEG
KCSLKKAELFPEGLRPALPEKHSSVKESFRYANLTCSSGKQVPGAPGRPSATKEMFITIE
FELETNQKEVTASCDLSCLVKRTEKRLRKAIRTLRKAAHREQFHLQLSGMDLDVAKKAPR
TSERRVESCAVGQGHVGNQCVSCRAGTYYDGAQERCILCPNGTFQNEEGQITCEPCPRPD
NPGPLKTPEAWNASDCGGLCQPGEYSADGFTPCQPCALGTFQPEAGRTSCFPCGGGLPTK
HLGATSFQECETRVQCSPGHFYNTTTHRCIRCPAGTYQPEFGKNSCVSCPGNTMTDFDGS
TNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPI
EDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQVPY
VTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREM
FPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences F6S9U1
ENSECAP00000008220 ENSECAP00000008220 9796.ENSECAP00000008220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]