SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008226 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008226
Domain Number 1 Region: 645-800
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-36
Family MAM domain 0.00059
Further Details:      
 
Domain Number 2 Region: 54-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-32
Family MAM domain 0.0055
Further Details:      
 
Domain Number 3 Region: 963-1126
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-30
Family MAM domain 0.0033
Further Details:      
 
Domain Number 4 Region: 803-960
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-27
Family MAM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 261-414
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-17
Family MAM domain 0.024
Further Details:      
 
Domain Number 6 Region: 478-634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-16
Family MAM domain 0.015
Further Details:      
 
Domain Number 7 Region: 216-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 8 Region: 444-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008226
Domain Number - Region: 17-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0157
Family LDL receptor-like module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008226   Gene: ENSECAG00000010162   Transcript: ENSECAT00000010634
Sequence length 1209
Comment pep:known chromosome:EquCab2:25:38414407:38422133:1 gene:ENSECAG00000010162 transcript:ENSECAT00000010634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLSLLAAGFPGWAWVPNHCKTPSEAVCNFVCDCRDCSDEAQCGYQGASPTVGAPFVCDFE
QDSCGWRDISTSGYSWLRDRAGAVLEGPGPHSDHTLGTDLGWYMAVGTHRGKEVSTAALR
SPILHEAGPACELRLWYHTASGDVAELRLELTHSMETLTLWQSSGPWGPGWQELVVATGR
IRGNFQVTFSATRNATHRGTVALDDLAFWGCGLPTPQARCLPGHHHCQNKACVEPHQLCD
GDDNCGDGSDEDTPLCSHHMATNFETGLGLWDNLEGWARNHSTSSPERPAWPRRDHSWNS
AQGSFLVSVAEPSAPAILSSPEFQASGPHNCSLVFYHYLHGSEAGSLQLLLQTGGPGAPQ
APVLLRRRHGELGAMWVRDRVDIQSKHPFRIVLAGQTGPGGIVGLDDLILSDHCKPVLVV
SGPPPGLWAPVPWPQPSSLQPWDFCEPGHLSCGDLCVPPEQLCDFQQQCMGGEDEQECGT
TDFETPMAGGWEDASVGRLQWGRHLAQESRVPSTHASGAAAGYFLSVQRAWGQLTAEARV
LTPALGPSGPRCELHMAYYFQSHPQGFLALVVVEDGNRELVWQVPSSSSGGWKVDTVLLG
ARHRPFWLEFVGLVDLDGPGHQGAGVDNLIMKDCSPTATSETDTEISCNFERDTCGWHIS
HLTDSHWHRMESHGPGYDHTTGRGYFMLLDPTDPPARGPGAQLLTQPQVPAGSRECLSFW
YHLHGPQIGTLRLVMRRDGEVDTHLWSRSGTHGNRWHEAWATLHHQLDSGTKYQLLFEGL
RNGYHGTMALDDVAVRPGPCWAPKRCSFEDSACGFSTRGQGLWMRQTNATGHTAWGPRAD
HTTETAQGHYMVVNTSPQALPRGHIASLTSEEHRPLAQPACLTFWYHLSLQNPGTLQVHV
EEARRRQVLSISAHGGFAWRLGSVDVQAEQAWRVVFEAVAAGVEHSYIALDDLLLQDGPC
PRPASCDFEAGLCGWSHLPWPSLGGYSWDWSSGDTPSRYPQPSVDHTLGTEAGHFALFET
GVLGPGGRAAWLRSQPLPPTVVSCLRFWYHMGFPEHFYKGELRVLLSSAQGQLVLWGAGG
HLRHQWLESRLEVASTEEFQIVFEATLGGQPALGPIALDDIEYLAGQRCQLPAPSQGQTA
ATHSMPAVVGGALLLLVLLVLLALVGRHWLWKKGDCAFGAKRAAAAPGFDNILFNADGVI
LPVSVTNDQ
Download sequence
Identical sequences F6S9L8
ENSECAP00000008226 9796.ENSECAP00000008226 ENSECAP00000008226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]