SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008265 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008265
Domain Number 1 Region: 397-498
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 184-244
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000229
Family B-box zinc-binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 24-57
Classification Level Classification E-value
Superfamily RING/U-box 0.000000788
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008265
Domain Number - Region: 223-328
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000484
Family Apolipoprotein 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008265   Gene: ENSECAG00000010259   Transcript: ENSECAT00000010674
Sequence length 580
Comment pep:known chromosome:EquCab2:5:51980002:51988258:1 gene:ENSECAG00000010259 transcript:ENSECAT00000010674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENRKPLMGFMGKLPSGTALGNSGKTHCPLCMGLFKVPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDSDTSSEGSIFQELKPCSLQPQIGILCPVCDAQVDLPMGGVKALTIDHLAVND
VMLESLRGEGQGLVCDLCSDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLK
AYSRTGKPILCPAHPAEELRLFCELCDQPVCRDCVVGEHREHPYDFTSNVIHKHGDSVRE
LLKDTQPHVEALEEALAQIKGTNSALQERVEAVAADVRTFSEGYIKAIEEHRDKLLKQLE
DIRVQKENSLQLQKAQLEQLLADMRTGVEFTQHLLTSGSDLEILITKGVVVERLTKLNQV
EYSVHPGVNNKICFFPQGKAGLCRGYEVYGTISTKEVDPTKCVLQGEDLHRAREKQPATF
TLLCKDAAGDSMGRGGDNIQVAVVPKDKKDSPVRTMVHDNKDGTYYISYTPKEAGVYTVW
VCIKEQHVQGSPFTVTVRKRHRPHPGVFHCCTLCSSGGQKTAHCACGGTMPGGYLGCGHG
HKGHPGCPPWSCCGKFTEKSECMWTGGQGAPRSLLRTVAL
Download sequence
Identical sequences F6RUP9
ENSECAP00000008265 XP_001500665.1.31192 9796.ENSECAP00000008265 ENSECAP00000008265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]