SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008269 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008269
Domain Number 1 Region: 154-220
Classification Level Classification E-value
Superfamily Homeodomain-like 1.37e-23
Family Homeodomain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008269
Domain Number - Region: 13-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00628
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008269   Gene: ENSECAG00000010403   Transcript: ENSECAT00000010679
Sequence length 316
Comment pep:known chromosome:EquCab2:5:73781817:73786953:1 gene:ENSECAG00000010403 transcript:ENSECAT00000010679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPEPHLVADGPQHHHHLHHSQQPPPAAAPTQSLQPSPQQQPPPPPPPQQPPAQQLGSA
ASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAAHESFRPKLEQEDS
KSKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSF
ERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMF
PSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLIHGLGPGGQP
ALNPLSNPIPGTPHPR
Download sequence
Identical sequences F6RUK8
ENSECAP00000008269 9796.ENSECAP00000008269 ENSECAP00000008269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]