SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008317 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008317
Domain Number 1 Region: 19-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 227-341
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 430-467
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 140-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 186-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 391-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008317
Domain Number - Region: 341-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00393
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008317   Gene: ENSECAG00000010409   Transcript: ENSECAT00000010736
Sequence length 745
Comment pep:known chromosome:EquCab2:10:4357317:4367506:1 gene:ENSECAG00000010409 transcript:ENSECAT00000010736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMI
TISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDAS
SSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPA
SEPPGSLCPGGTFPCSGLRSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGS
FASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQT
LSYRSNHQPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSGDGDAG
DPGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCP
DGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIG
SLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPP
VEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPL
LTAARTSQTVLGDGLLQPAPGAAPDPPAPRTDTGSPGAAGDGLPSAHCHAPEVGPSVPAP
LGLREPECGPVDKDRKACRDPLVDSPAPMDTPRELCLAQDPQPPAPTASSTLGPHPPEPL
GVCRSPPPPCSPALEASDDEALLVC
Download sequence
Identical sequences F6QUE6
ENSECAP00000008317 9796.ENSECAP00000008317 ENSECAP00000008317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]