SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008407 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008407
Domain Number 1 Region: 256-339
Classification Level Classification E-value
Superfamily E set domains 2.33e-19
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008407   Gene: ENSECAG00000010003   Transcript: ENSECAT00000010842
Sequence length 601
Comment pep:known chromosome:EquCab2:22:19983793:20046789:-1 gene:ENSECAG00000010003 transcript:ENSECAT00000010842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAQDALPRGGLNLKEEPLLPAGLGSVRSWMQGAGILDASTAAQSGIGLARAHFEKQPP
SNLRKSNFFHFVLAMYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNG
LRTEQDLYVRLIDSMSKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDRKSCGNRNETPSD
PVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSK
HGRRARRLDPSEAATPCIKAISPGEGWTTGGATVIVIGDNFFDGLQVVFGNVLVWSELIT
PHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRH
PGDPERLPKEVLLKRAADLAEALYGVPSSNQELLLKRAADVAEALYSAPRAPAPLGPLAP
SHPHPAVVGINAFSSPLAIAVGDATPGPEPGYARSCSSASPRGFAPSPGSQQSSYGSGLG
AGLGGYGAPGVAGLGVPGSPSFLNGTATSPFAIMPSSPPLAAASSMSLPAAAPTTSVFSF
SPVNMISAVKQRSAFAPVLRPPSSPTQACPRAHGEGLPDQPFEDSDKFHSPARGLQSLAY
S
Download sequence
Identical sequences F6PH34
ENSECAP00000008407 9796.ENSECAP00000008407 ENSECAP00000008407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]