SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008470 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008470
Domain Number 1 Region: 249-420
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.05e-58
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000219
Further Details:      
 
Domain Number 2 Region: 419-544
Classification Level Classification E-value
Superfamily E set domains 1.51e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008470   Gene: ENSECAG00000010266   Transcript: ENSECAT00000010911
Sequence length 1509
Comment pep:known chromosome:EquCab2:3:19652719:19708283:1 gene:ENSECAG00000010266 transcript:ENSECAT00000010911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSF
TTSSSPTIYSTSVTDSKAMQVESCSSALGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYI
SPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKR
NPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVK
KSPMLCGQYPVKCEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEP
VVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDC
VGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQPAGV
PEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHL
IVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAASALNVNVKKEISSPARP
CSFEEAMKAMKTTGCNLDKVNILPNALITPLISSSMIKSEDVTPMEVTAEKRSSPIFKTT
KTVGSTQPTLENISNIAGNGSFSSSSSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDIS
QPGTFPAVSASSQLPSSDALLQQATQFQTREAQSREVLQSDGTVVNLSHLTEASQQQQQS
PLQEQAQTLQQQISSNIFPSANSVSQLQSTIQQLQAGSFTGSTASGSSGNVDLVQQVLEA
QQQLSSVLFSAPDGNDNVQEQLSADIFQQVSQIQNSVSPGMFSSTEPAVHTRPDNLIAGR
AESVHPQTENTLSNQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGN
LQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETATTTTQQVATPGTTMFQTS
SSGDGEETGVQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNTGGQQQGNGL
FQQSNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSIFHSPSPIVHSQNS
TTSSEQMQPPMFHSQSTMAVLQGSSVPQDQQSANIFLSQSPMNNLQTNTVAQEEQISFFA
AQNSISPLQSTSNTEQQAAFQQQSPISHIQTPMLSQEQAQPSQQGLFQPQVSLGSLPPNP
MPQNQQGAIFQSQHSIVAIQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASQ
KQPPPNMIFNPSQNPMANQEQQNQSIFHQQNNMTPMNQEQQPMQFQNQPTVSSLQNPGPT
QSESSQTSLFHSSPQIQLVQGSSSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQ
NNMPGIQGATSSPQPQATLFHNTTGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSG
PATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLATSINANQNIEKMDLLVSLQN
QGNNLTGSF
Download sequence
Identical sequences F6SFE8
ENSECAP00000008470 ENSECAP00000008470 9796.ENSECAP00000008470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]