SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008520 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008520
Domain Number 1 Region: 31-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000765
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008520   Gene: ENSECAG00000010656   Transcript: ENSECAT00000010964
Sequence length 135
Comment pep:known chromosome:EquCab2:14:36492030:36499880:1 gene:ENSECAG00000010656 transcript:ENSECAT00000010964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAFSSKPQALVTPSKEERGKKKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCI
CHPGYHGERCHGLTLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYD
VENEEKVKLGMTTSH
Download sequence
Identical sequences F6RH07
9796.ENSECAP00000008520 ENSECAP00000008520 ENSECAP00000008520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]