SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008550 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008550
Domain Number 1 Region: 20-349
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 8.17e-40
Family Serum paraoxonase/arylesterase 1, PON1 0.00000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008550   Gene: ENSECAG00000010414   Transcript: ENSECAT00000010997
Sequence length 354
Comment pep:known chromosome:EquCab2:4:38762941:38794452:-1 gene:ENSECAG00000010414 transcript:ENSECAT00000010997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLAALTLLGIALALLGERLLLFRNRLKTSREIESLDLPNCRLIKGIEAGSEDIDILPN
GLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEENPRALELRISRGFNLASFNPHGISTFI
DTDDTVYLFVVNHPEFRNTVEIFKFEEEDNSLLHLKTIKHELLPSVNDIVAVGPAHFYAT
NDHYFSDTFLKYLETYLNLHWTNVVYYSPNEVKVVAEGFDTANGINISPDKKYIYVADIL
AHEIHVLEKHPNMNLTHLKVLELDTLVDNLSIDPSSGDILVGCHPNGQKLLVYDPNNPPS
SEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVYDRKLLIGTLYHRALYCEL
Download sequence
Identical sequences F6R1T9
ENSECAP00000008550 XP_001494227.2.31192 XP_014708815.1.49734 ENSECAP00000008550 9796.ENSECAP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]