SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008610 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008610
Domain Number 1 Region: 170-244
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-26
Family Homeodomain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008610
Domain Number - Region: 62-110
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008610   Gene: ENSECAG00000010760   Transcript: ENSECAT00000011064
Sequence length 303
Comment pep:known chromosome:EquCab2:4:48183664:48245941:-1 gene:ENSECAG00000010760 transcript:ENSECAT00000011064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPLFGCLRSPHATGQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG
SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKS
EVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK
WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQPTGDSLANEDSHDSDHSSEH
AHL
Download sequence
Identical sequences F6Q253
ENSECAP00000008610 9796.ENSECAP00000008610 ENSECAP00000008610 XP_001915765.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]