SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008620 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008620
Domain Number 1 Region: 357-533,568-734
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.56e-82
Family YicI catalytic domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 1227-1426,1471-1632
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-77
Family YicI catalytic domain-like 0.00046
Further Details:      
 
Domain Number 3 Region: 112-356
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.71e-51
Family YicI N-terminal domain-like 0.0086
Further Details:      
 
Domain Number 4 Region: 980-1224
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-45
Family YicI N-terminal domain-like 0.0062
Further Details:      
 
Domain Number 5 Region: 1635-1715
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.73e-20
Family Putative glucosidase YicI, domain 3 0.0098
Further Details:      
 
Domain Number 6 Region: 737-819
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000209
Family Putative glucosidase YicI, domain 3 0.018
Further Details:      
 
Domain Number 7 Region: 950-1002
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000144
Family Trefoil 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008620   Gene: ENSECAG00000009647   Transcript: ENSECAT00000011076
Sequence length 1859
Comment pep:known chromosome:EquCab2:4:94788854:94860854:1 gene:ENSECAG00000009647 transcript:ENSECAT00000011076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKWKNFTTLELMLSALLLVLFIITIPIFVLSARDSLGSEGPNSDTFWSPYPGTTVTP
DPGTTVTLNPSSTAIPDHETTTTVPASAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGPISVPWCYYSQSHGYQMEDNLVNTNAGFTAQLKRLPSPSLFGNDVNNVLLTAECQTS
NRFHFKLTDQNQDRYEVPHEHVQSFNGNAASALTYEVTVSKQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGDGTNLY
GAQTFFLCLEDASGLSFGVFLLNSNAMEVSLQPAPAVTYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYDYGSLDNMKEVVERNRAAQLPYDVQHADIDYMDER
KDFTYNPVDFKDFPEFAKELHNNGQKLIIIVDPAISNNSSPSQPYGPYDRGSDMKIWVNA
SNGVTPLIGEVWPGKTVFPDYTNPQCAVWWAREFELFHNQVDFDGIWIDMNEVSNFIDGS
VSGCSTSDLNYPPFTPRVLDGYLFSKTLCMDAVQYWGKQYDVHNVYGYSMAIATAEAVNT
VFPSKRSFILTRSTFAGSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICG
FFLDSSEELCRRWMQLGAFYPFSRNHNGQGYKAQDPAFFGADSLLVNSSRHYLTIRYTLL
PYLYTLFYRAHSRGDTVARPLLHEFYGDSSTWDVHQQFLWGPGLLITPVLEEASGAEKVM
AYMPDAVWYDYETGGRVRWRKQQVEMDLPGDKIGLHLRGGYIFPTQQPATTTVASRRNPL
GLIIALDENKEAKGELFWDDGETKDTVANQVYLLCEFSVTQNRLDVKILQSTYKDPNNLV
FKEIKILGTQEPWNVTVKHNGVSSQMSPNVTYDSNLQVALITELDLILGEAYTVEWELKV
ADEEKIDCYPDENGVSAENCTARGCVWEESSSPGVPFCYFVSDLYSVSDVQYDTHGATAV
ISLNSSPYAYALPSIPVNSLHLNVTYHKNDMLQFKIYDPNNNRYEVPVPLNIPQVPSSTS
ESRLYDVLIKKNPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSRYLYGFGENE
HTAFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQ
PLPALTYRTTGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTE
IANLYDDMVAAQIPYDVQYSDIDYMERQMDFTLSPKFAGFPDLITRMHADGMRVILILDP
AISGNETQPYPAFTRGVEDDVFIKAPGGGGIVWGKVWPDFPDVVVNDSLDWDTQVELYRA
YTAFPDFFRNSTVKWWKREFEELYSNPQNPEKSLKFDGMWIDMNEPASFVNGAVPPGCMN
ATLNHPPYMPYLESRDSGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQ
EVTGQRGIVITRSTFPSSGRWAGHWLGDNTAAWDQLRKSIIGMMEFSLFGISYTGADICG
FFQDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDPVSWDATFVNISKTVLQTRYTLLPY
LYTLMHLAHTEGSTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLEPNARNVTAYFP
RARWYDYYTGEDIKARGEWKSLPAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFIGFKV
ALDDDGTAEGCLFWDDGQSIDTYEKGLYYLANFSASQNTMQSHVIFNQYIVDTNPLKLGY
IEIWGVGSAPVSNVSVSLSSTVITPAFTYNPTTQVLNIDVTSRDISLHNFISLTWSSTL
Download sequence
Identical sequences F6PUW3
9796.ENSECAP00000008620 ENSECAP00000008620 ENSECAP00000008620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]