SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008622 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008622
Domain Number 1 Region: 42-509
Classification Level Classification E-value
Superfamily Sema domain 5.36e-151
Family Sema domain 0.0000000152
Further Details:      
 
Domain Number 2 Region: 512-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000118
Family Plexin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008622   Gene: ENSECAG00000010510   Transcript: ENSECAT00000011078
Sequence length 770
Comment pep:known chromosome:EquCab2:15:28451021:28474951:-1 gene:ENSECAG00000010510 transcript:ENSECAT00000011078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASAARPRPGPGPPSASPFPLLLLAVLSGPVCGRVPRSVPRTSLPISEADSYLTRFTVP
QTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKED
ECHNFIQILAIANASHLLTCGTFAFDPKCGVIDVSSFQQVERLESGRGKCPFEPAQRSAA
VMAGGVLYAATVKNYLGTEPIISRAVGRAEDWIRTETLPSWLNAPAFVAAVALSPAEWGD
EDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGRKTLQQRWTTFLKSDLLCPGP
EHGRASSVLQDMAILRPEHGLRTPIFYGIFSSQWEGAAISAICAFRPQDIRSVLNGPFRE
LKHDCNRGLPVMDNDVPQPRPGECITNNMKLQQFGSSLSLPDRVLTFIRDHPLMDRPVFP
ADGHPLLVTTDTGYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLAL
FPEPQPVENMKLYQSWLLVGSHTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDACV
AHAGAHGGLVQDIESADVSSLCPKEPGEHPVVFEVPVGTAAHVVLPCSPSSAWASCVWHQ
PSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAARVVAAYSLVWGSQRGLPGRAHTVW
AGLAGFFLGVLAASLTLLLIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPS
PEDERLPLALAKRGSGFGGFPPPFLLDPCPSPAHIRLTGAPLATCDETSI
Download sequence
Identical sequences F6PUR8
ENSECAP00000008622 XP_001916582.1.31192 9796.ENSECAP00000008622 ENSECAP00000008622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]