SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008645 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008645
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000221
Family Myb/SANT domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008645   Gene: ENSECAG00000010776   Transcript: ENSECAT00000011105
Sequence length 144
Comment pep:known chromosome:EquCab2:3:24456197:24466745:1 gene:ENSECAG00000010776 transcript:ENSECAT00000011105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFTDADDLAILTYVKENARSPSSVTGNALWKALEKSALTQHSWQSLKDRYLKRLRGQEH
KYLLGDAPVSPSSQKLKRKAEQDPEAADSGEPQNKRTPDLPEEEFVKEEIQENEEAVKKM
LVEASREFDEIVVDESPDFEIHIT
Download sequence
Identical sequences F6PMP4
9796.ENSECAP00000008645 ENSECAP00000008645 ENSECAP00000008645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]