SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008655 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008655
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.09e-34
Family Chaperone J-domain 0.0000443
Further Details:      
 
Domain Number 2 Region: 243-330
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.7e-23
Family HSP40/DnaJ peptide-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 159-241
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.11e-16
Family HSP40/DnaJ peptide-binding domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008655   Gene: ENSECAG00000010808   Transcript: ENSECAT00000011116
Sequence length 337
Comment pep:known chromosome:EquCab2:5:84789441:84799501:-1 gene:ENSECAG00000010808 transcript:ENSECAT00000011116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDYYGILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKK
REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMAGGR
DPEEMEIDGDPFGAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYNGCTKRMK
ISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPTSIPADIVFIIKDKDH
PKFKRDGSNIVYTAKISLREALCGCSINVPTMDGRTIPMSINDIVKPGMRRRIIGYGLPF
PKNPDQRGDLLIEFDVSFPDAISSSSKEVLRKHLPAS
Download sequence
Identical sequences F6PM07
ENSECAP00000008655 9796.ENSECAP00000008655 XP_001498148.1.31192 XP_005610537.1.31192 XP_008517235.1.77740 XP_008517236.1.77740 XP_008517237.1.77740 XP_014705373.1.49734 XP_014705380.1.49734 ENSECAP00000008655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]