SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 69_2 > ENSECAP00000008671

Domain assignment for ENSECAP00000008671 from Equus caballus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000008671
Domain Number 1	Region: 179-219
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000000127
Family	EGF-type module	0.0069
Further Details:

Domain Number 2	Region: 89-142
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000276
Family	EGF-type module	0.0028
Further Details:

Domain Number 3	Region: 136-169
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000373
Family	EGF-type module	0.01
Further Details:

Domain Number 4	Region: 40-77
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000525
Family	EGF-type module	0.019
Further Details:

Weak hits

Sequence:	ENSECAP00000008671
Domain Number -	Region: 5-29
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0187
Family	EGF-type module	0.037
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000008671 Gene: ENSECAG00000010815 Transcript: ENSECAT00000011133
Sequence length	233
Comment	pep:known chromosome:EquCab2:7:44370546:44376746:-1 gene:ENSECAG00000010815 transcript:ENSECAT00000011133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	CAPWCPRNSVCVSATTCRCRPGFSSWSGEIITSPADSCDDINECGPPLAVSCGKFADCQN VDGSHYCTCSPGYGLVSGATTFRNESENTCQDVDECQQKPRICKGRSVCINTLGSYTCTC PPGLELNPKDPNLCTDVNECASGHNPCHSSTHCLNIVGGYKCHCYPGWKPVPGSPEGPDS TICADVDECSSGRHPCHSSTICVNTVGSYRCHCHPGWTPLPGLRDNQNTTVCE
Download sequence
Identical sequences	F6T1G1 9796.ENSECAP00000008671 ENSECAP00000008671 ENSECAP00000008671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]