SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008691 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008691
Domain Number 1 Region: 436-718
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.88e-72
Family Protein kinases, catalytic subunit 0.000000213
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008691
Domain Number - Region: 336-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0938
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008691   Gene: ENSECAG00000010591   Transcript: ENSECAT00000011154
Sequence length 825
Comment pep:known chromosome:EquCab2:1:147223799:147231499:1 gene:ENSECAG00000010591 transcript:ENSECAT00000011154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSGWLLLWLGAAGTILCSSSESQGPFLPSSLLPLPAPSPRVPNVTAPLTGSEPASPLI
HRGTHGPWRFSTCGASGPRGPTQTQCDGAYAGSSVVVTVGAAGPLRGVQLWRSPGPGQYL
ISAYGAAGGTGARNHLSRAHGVFISAVCSLRGGEPLYILVGQQGEDACPGGSPESRLVCL
GESRAAEEHVATDGTEGVPGSRDWDERRFGGGGGACTAGALIQAGVPQRLSGKGIRPRSF
QARAGPFPSQQIPSFLELAELASWAGRQTGKDGGDASETDILWADGEDGVSYIHPSNELY
LQPLAVTENHGEVEIRQHFNCSHCLLKDCQWQGELQWAECMCPEGMELAADNITCMDLPT
PPGPLVLMVAVVVTLTLSLLMVCVVLILVNHQKWQGLWGTRLPGPELMELSKLRTSTIKT
APNPYYCQLGLGPAQSWPLPPGLTEVSPANVTLFRALGHGAFGEVYEGLVTGLPGDPNPL
QVAIKTLPELCSPQDELDFLMEALIISKFSHQNIVRCVGLSLRAAPRLILLELMSGGDMK
SFLRRSRPHLDQPSPLAMQDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCTGHGRV
AKIGDFGMARDIYRASYYRKGGRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSL
GYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHQPELRPSFASILERLQY
CTQDPDVLNSPLPMELGPTLEEEGASGLGSRSLEGLRSPQTQELSLESLKSWGGSLLGPW
LPSGLKPSKIRGLQLQNLWNPTYGSWAPRGPEGEDSGIDGSNSSS
Download sequence
Identical sequences F6T051
ENSECAP00000008691 9796.ENSECAP00000008691 ENSECAP00000008691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]