SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008702 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008702
Domain Number 1 Region: 463-677
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.51e-31
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 2 Region: 912-1112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-27
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 3 Region: 690-892
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.18e-27
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 4 Region: 225-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000193
Family EGF-type module 0.006
Further Details:      
 
Domain Number 5 Region: 149-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000357
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 6 Region: 187-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000628
Family EGF-type module 0.004
Further Details:      
 
Domain Number 7 Region: 1298-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000144
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 8 Region: 305-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000183
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000196
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 10 Region: 263-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000031
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 11 Region: 379-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 12 Region: 73-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.027
Further Details:      
 
Domain Number 13 Region: 1177-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1216-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000182
Family EGF-type module 0.03
Further Details:      
 
Domain Number 15 Region: 1265-1303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000208
Family EGF-type module 0.032
Further Details:      
 
Domain Number 16 Region: 113-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000252
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008702
Domain Number - Region: 925-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00466
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 340-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00988
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008702   Gene: ENSECAG00000010669   Transcript: ENSECAT00000011167
Sequence length 1407
Comment pep:known chromosome:EquCab2:30:24999325:25195424:1 gene:ENSECAG00000010669 transcript:ENSECAT00000011167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALQKINYLLIFYLSFSPFIYIKNSFCNKNDTNCLSNSCQSNSTCNGFSKDSDCRCSDT
ASNLDKGCDNMKDPCFSSPCQGNATCVNTPGERSFLCKCPPGYNGTTCETVTSSCGMNSC
QHGGICRQDPVHPVCLCPAGYAGRFCEMDHDECASSPCHNGAVCQDGLNGYSCFCVPGFQ
GRHCDLEVDECVSDPCKNAGTCLNEIGRYTCVCPQDYSGVNCEMEIDECWSQPCLNGATC
QDALRAYFCACTPGFLGDHCELNVDECASQPCLHGGLCVDGSNRYSCNCKGSGFTGTHCE
TLMPLCWSQPCHNNATCEDSADNYTCHCWPGYTGAQCETDINECSSNPCQSDGECVERSS
EQQYGRLAQLPSSFSYPEASGYVCICQPGFTGIFCEEDIDECSSNPCQNGGTCENLPGNY
TCHCPFDNRSGTFYGGRDCSDILLGCTHHQCLNNGICIPHFQNGQHGFSCLCPSGYTGSL
CEIVTTLSFEGNGFLGVTSGSVTAEGSVCSIALKFQTVQPMALLLLRGDGDMFVMLELLS
GYIHLSVQVNNQSKVLLYISHNTSDGEWHSVEVVFADTVTLTLLDDSCKEKCITKAPSPF
GKDRSICAFPNSFLGGLPMGMNSNGVALLNIYNRPSTPSFVGCLQDIKIDSNHITPENIS
SGSSLNIKPGCMRKDWCESQPCQNRGRCTNLWLSYQCDCHRPYGGLNCLKEYVAGRFGQD
DSSGYAVFNLDKSYGENFTLSMFVRTHRPSGLLLALGNSTYQFIRVWLEHGRLAMLNPSS
PKLVVKFVLSDGNIHLISLKIKPNKIELYQSSQNLGFISAPTWNIQRGDVIYIGGLPDRQ
ETEVNGGFFKGCVQDIRLNNQNLEFFPNSTSNSSRNPILVNVTQGCPGDDMCKSNPCHHG
GVCYSLWDDFSCSCPANTAGKACEDVQWCELSPCPSGAQCQLVPQGFECTANAVFNGQSS
EILFRSNGNITRELTNITFGFRTRDASGIILHAEKEPEFLSISIRDSRLLFQLQSGNSFY
MLSLTSVQSMNDGIWHQVSLSMTDPLAQASRWQMEVDNQTPFVTSAVATGSLNFLKDNTD
IYVGHRASDNMQGLQGCLSTIEIGGIYLSYFENVRGFIKKPQQEQFLKTSVNSVVTGCLQ
LNACNSNPCLQGGDCEDIYSSYHCSCPLGWSGTQCELNIDECFSNPCIHGNCSDRLAAYH
CKCEPGYTGVNCEAFIDNCRSHQCANGATCISDANGYSCRCSGNFTGKFCRHSRLPATVC
GNEQTNLTCYNGGSCTEFPGGFKCVCRPGFTGERCEKDIDECASDPCFNGGLCQDLLNRF
QCLCDVAFAGERCEIDLAGDLISDIFTAIGSVTLALLLILFLAIAASVVASNKRATQGTY
SPSRQEKEGSRVEMWSMMPPPVMERLI
Download sequence
Identical sequences F7CHP4
9796.ENSECAP00000008702 ENSECAP00000008702 ENSECAP00000008702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]