SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008739 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008739
Domain Number 1 Region: 179-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000727
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 83-171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000753
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008739
Domain Number - Region: 41-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008739   Gene: ENSECAG00000010232   Transcript: ENSECAT00000011207
Sequence length 773
Comment pep:known chromosome:EquCab2:7:44107598:44138848:1 gene:ENSECAG00000010232 transcript:ENSECAT00000011207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCAPWCPRNSVCINAIACRCHPGFSSWSGEIITSPVDSCDDINECEPPLAVSCGKFADCQ
NVDGSHYCTCSPGYGLVSGATTFRNESENTCQDVDECQQKPRICKGHSVCINTLGSYNCT
CLLGLELNLKDLNLCTDVNECASGHNPCHSSTHCLNIVGGYKCRCHPGWKPVPGSPEGPD
GTVCADVDECSSRQHRCHNSTACINTVGSYRCRCRRGWTPLPGFQDNQNTTVCEEMSFPT
WTPPPGIQSQCLSGFFERVQDLRRRFTPASAQDTVQDLIQSVDELLKAPGDLETLALPDR
HHTVTHLLSGLEEVLRTLAKAMPGASFTYQSPAGTELSLVIQEQGHGNVTLGQSHARMLL
DWAVAAGSAGSGPAVAGILSNPNMQKLLANASLELDPERQAKLEETHESPLYGVQWRLLS
AVNSVFLSNTNTTKLDPKVTFAFSHPVSPGAGRAPQDTDVEKPGTRQELICAFWKGADDG
GGHWATSGCWTLGSWNNSTTCQCSHLSSFAVLMAHYDVQDPMLAVITHVGLSLSLLCLLL
AALTFLLCRAIQNTSTSLHLQLSLCLFLAHLLFLTAMDRTEIQVLCSVIAGALHYLYLAS
FTWMLLAGLHLFLTARNLTVVNYSSKLMFPVGYGVPAVIVAISAASRPDLYGTPTRCWLR
SESGFIWGFLGPVCAIFSVNLAFFLMTLWILKSRLSLLNSDVSTLQNTRMLTFKATAQLF
ILGCTWCLGILQVGPAAHVMAYFFTIINSLQGVSIFLVYCLLSQQVREQYGKW
Download sequence
Identical sequences F7DQH2
ENSECAP00000008739 9796.ENSECAP00000008739 ENSECAP00000008739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]