SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008740 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008740
Domain Number 1 Region: 246-411
Classification Level Classification E-value
Superfamily vWA-like 8.48e-27
Family Integrin A (or I) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008740   Gene: ENSECAG00000010809   Transcript: ENSECAT00000011208
Sequence length 922
Comment pep:known chromosome:EquCab2:4:26623297:27110715:-1 gene:ENSECAG00000010809 transcript:ENSECAT00000011208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLALILTLFQSMLIGPLSEEPFPRAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQ
DLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYY
NAKDDLDPEKNDSEPGSQRIKPVFIDDTNFGRQISYQHAAVHIPTDIYEGSTIVLNELNW
TSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYI
QGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQ
HLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGG
EERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQE
YLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQVENKTNLKNQLIL
GVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDA
ELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLP
TYSFYYIKAKIEETITQARSKKGKMKDSETLKPDNFEESGYTFIAPRDYCNDLKISENNT
EFLLNFNEFIDRKTPNNPSCNTNLINRVLLDAGFTNELVQNYWSKQKNIKGVKARFVVTD
GGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKA
VEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGG
FLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDYQSVCEPGATPKQGAGHR
SAYVPSIADILQIGWWATAAAW
Download sequence
Identical sequences F7DQG7
9796.ENSECAP00000008740 ENSECAP00000008740 ENSECAP00000008740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]