SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008771 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008771
Domain Number 1 Region: 262-435
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000183
Family Soluble quinoprotein glucose dehydrogenase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008771   Gene: ENSECAG00000010860   Transcript: ENSECAT00000011247
Sequence length 446
Comment pep:known chromosome:EquCab2:17:29453681:29468172:1 gene:ENSECAG00000010860 transcript:ENSECAT00000011247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFSNFTGSKDDRGTCQCSITLPDTTFPVERVERLEYTAHILSEKFKIELSKVKEYVHLI
SVYEKKLVNLTVRVEIMEKDTIQYSELDFELIKIEVKEMQKLIIRLKESFVGSSEIVDQL
EVEIRNLTLVVEKLETLDKNNVLSIRREIVALKDRLKECEASKSEMVPATPPPPAPGSCS
HGGVVNVSRPAVVQLNWQGFSYKYGAWGRDYSPQHPGTGLYWVAPLNTDGRYLEYYRLYN
TLDDLLLYKHAQHYRIAYGQGSGTAVYNNNMYVNWYNTGNIAKVNLSTNKVAVTETLPNA
AYNNRFSYANVAWQDIDFAVDENGLWVIYSTEANTGNMVISKLNDTSLVVLNTWYTKQYK
PSVSNAFMVCGVLYATRTLSTRTEEIFYYYDTNTGKEGRLEIAMHKMQENVHSINYHPFD
HKLYVYNDGYLLNYDVIFKREPQQDV
Download sequence
Identical sequences F7DPZ6
ENSECAP00000008771 9796.ENSECAP00000008771 ENSECAP00000008771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]