SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008777 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008777
Domain Number 1 Region: 9-128,320-628
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.28e-68
Family Integrin alpha N-terminal domain 0.0000559
Further Details:      
 
Domain Number 2 Region: 148-343
Classification Level Classification E-value
Superfamily vWA-like 1.31e-51
Family Integrin A (or I) domain 0.0000000156
Further Details:      
 
Domain Number 3 Region: 913-1114
Classification Level Classification E-value
Superfamily Integrin domains 2.67e-39
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 4 Region: 771-908
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-26
Family Integrin domains 0.0034
Further Details:      
 
Domain Number 5 Region: 631-770
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-17
Family Integrin domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008777   Gene: ENSECAG00000010739   Transcript: ENSECAT00000011253
Sequence length 1160
Comment pep:known chromosome:EquCab2:21:18911672:18961103:-1 gene:ENSECAG00000010739 transcript:ENSECAT00000011253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GILNCCMAYNVGLPEAKIFSGPSSEQFGYAVQQFLNPKGNWLLVGSPWSGFPENRMGDVY
KCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTRNVGTGGFLTCGPLWAQQCGS
QYYTTGVCSDVSPDFQLLASFSPAAQTCPSLIDVVVVCDESNSIYPWEAVKNFLEKFVQG
LDIGPTKTQVGLIQYANNPRVVFNLNTFKTKAEMVEATSQTFQFGGDLTNTFKAIQYARD
SAYSAAAGGRRGATKVMVVVTDGESHDGSMLKAVIDQCNSDNILRFGIAVLGYLNRNALD
TKNLIKEIKAIASIPTERYFFNVSDEVALLEKAGTLGEQIFSIEGTVQGGDNFQMEMSQV
GFSADYSPQNDILMLGAVGAYGWSGTVVQESSHGHLIFPKQAFDQILHDRNHSSYLGYSV
AAISTGKGVHFVAGAPRANYTGQIVLYSVNENGNITIIQTHRGDQIGSYFGSVLCSVDVD
KDAITDVLLVGAPTYMNDLKKEEGRVYLFTITKGILNWHQFLEGPDGVENARFGSAIAAL
SDINMDGFNDVIVGSPLENQNSGAVYIYNGHEGTIRLKYSQKILGSDGAFRSRLQYFGRA
VDGHEDLNGDSITDVSVGAFGQVVQLWSQSIADVSVDASFTPEKITLFNKNAEISLKLCF
SAKFRPTKQNSQVAITYNITLDADLYSSRVTSRGLFKENNERYLRKNMIVSQAQNCSEYI
IHIQEPSDVVNSLGLCVNISLENPGTSPALEAYSETAKVFSIPFHKDCGDDGICISDLVL
HVQQLPASQEQPFIVSNQNKRLTFSVTLKNKKESAYNAGIVVDFSENLFFASWSMPVDGT
EVTCQVASSQKSVTCDVGYPALKRKQKVTFTINFDFNLQNLQNQASVSFQAMSESHEENK
ADNSANFKIPLLYDADIHITRSTNINFYEVSSDGNVSSIVHNFEDIGPKFIFSIKVTTGS
VPVSMASVIIHIPQYTKEKNPLMYLTGVDTDQAGDISCNAEINPLKIGQTLSSVSFKSEN
FRHIKELNCRTASCRNVTCWLTDLQMKSEYFLNVSTRIWNGTFAASTFQTVQLTAPAEID
TYNPQIYVIEENTVTIPITIMKPHEKAEVPTGVIVGSVIAGILLLLALVAILWKLGFFKR
KYEKMAKNPEEIDETTELNS
Download sequence
Identical sequences F6RHG7
9796.ENSECAP00000022803 ENSECAP00000008777 ENSECAP00000022803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]