SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008811 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000008811
Domain Number - Region: 272-306
Classification Level Classification E-value
Superfamily Plexin repeat 0.00174
Family Plexin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008811   Gene: ENSECAG00000010672   Transcript: ENSECAT00000011291
Sequence length 470
Comment pep:known chromosome:EquCab2:11:23105942:23160563:1 gene:ENSECAG00000010672 transcript:ENSECAT00000011291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGWATKGTTQGWNRRARESPGQVSEPDRTQLSQDLGGGTLAIDTLPDNGTKVVEDNHSY
YVSRLYGPSEPRSRELWVDVAEANRSQVKAHRILSNTHRQASVKWCLSFDFPFYGHPLRQ
ITIATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVAYFDNGTVFVVQWDHVYL
QGREDRGSFTFQAALHRDGRIVFGYKEIPMSVLEISSSQHPVKAGLSDAFMILNPSPEVP
ESRRRTIFEYHRVELDPTKITSMSAVEFTPLPTCLQHRSCDACMSSDLTFNCSWCHVLQR
CSSGFDRYRQEWLTYGCAQEAEGRTCEDFQDEDHYSSSPESSFSPFEGDLTTTSSSLFID
SLTTEDDTKLNPYAGEDGLQDNLSPKTKGPPVHLGTIVGIVLAVLLVAAIILAGIYINGH
PTSNAALFFLERRPHRWPAMKFRNHPNHSTYTEVEPSGHEKEGFVEAEQC
Download sequence
Identical sequences F7CN19
9796.ENSECAP00000008811 ENSECAP00000008811 ENSECAP00000008811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]