SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008821 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008821
Domain Number 1 Region: 108-306,350-511
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.32e-73
Family YicI catalytic domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.63e-23
Family YicI N-terminal domain-like 0.0084
Further Details:      
 
Domain Number 3 Region: 514-594
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.08e-18
Family Putative glucosidase YicI, domain 3 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008821   Gene: ENSECAG00000010940   Transcript: ENSECAT00000011301
Sequence length 639
Comment pep:known chromosome:EquCab2:4:94917783:94937186:1 gene:ENSECAG00000010940 transcript:ENSECAT00000011301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSISTRLPSEYIYGFGETEHTAFKRNMSWHMWGMFARDEPPAYKKNSYSVHPYYMALE
EDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMFLGPTPELVTQQYTELVGRPA
MIPYWALGFQLSRYGYQNDTEISNLYDAMMAAQIPYDVQHVDIDYMDRKLDFTLSSSFQN
LGLLIEQMKKDGMRFILILDPAISGNETQYLTFTRGQENNVFIKWPDNSDIVWGKVWPDL
PNVIVDGSLDQETQVELYRAYVAFPDFLRNSTATWWKKEIEELYTNPREPEKSLKFDGLW
IDMNEPSNFVDGSVWGCRDETLNNPPYVPYLESRNKGLSSKTLCMESQQVLPDGSLVRHY
DVHSLYGWSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHWLGDNMAAWDQLKKSII
GMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWNS
TFEMISRNVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTVDNKTWEIDDQFMLGPA
ILISPVLESNTFEIHAYFPSARWYDYSTESGNTSTGEWKTLQAPLDHINLHIRGGYILPW
QESAMNTYSSRQKFMGLIVALDDNGKAEGEMFWDDGQSI
Download sequence
Identical sequences F7DGG1
ENSECAP00000008821 ENSECAP00000008821 9796.ENSECAP00000008821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]