SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008923 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008923
Domain Number 1 Region: 590-889
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-81
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-72
Family Ephrin receptor ligand binding domain 0.000000238
Further Details:      
 
Domain Number 3 Region: 299-507
Classification Level Classification E-value
Superfamily Fibronectin type III 6.27e-40
Family Fibronectin type III 0.0000864
Further Details:      
 
Domain Number 4 Region: 886-959
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.3e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008923
Domain Number - Region: 227-297,338-357
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000229
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008923   Gene: ENSECAG00000009755   Transcript: ENSECAT00000011414
Sequence length 962
Comment pep:known chromosome:EquCab2:19:22912478:22923199:1 gene:ENSECAG00000009755 transcript:ENSECAT00000011414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLMDTKWVTSELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWR
RDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDT
IAPDESFSRLDAGRVNTKVRSFGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGF
ALFPETLTGAEPTSLVIAPGTCIANAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAA
KESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTV
PSPPRGVISNVNETSLILEWSEPRDLGGRDDLLYNVICKKCHGGPGAGGPSACSRCDDNV
EFVPRQLGLTERRVHISHLLAHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEV
PTLHLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPD
ARYVVQVRARTVAGYGQYSHPAEFETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVV
IAVVCLRKQRHGSDSEYTEKLQQYITPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIE
EVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIR
LEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVH
RDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFT
SASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWV
RDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDA
IKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPV
QV
Download sequence
Identical sequences F7C2E5
ENSECAP00000008923 9796.ENSECAP00000008923 ENSECAP00000008923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]