SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008929 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008929
Domain Number 1 Region: 1146-1372
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.99e-40
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 176-288
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-29
Family Cadherin 0.00086
Further Details:      
 
Domain Number 3 Region: 500-607
Classification Level Classification E-value
Superfamily Cadherin-like 6e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 609-714
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-29
Family Cadherin 0.0006
Further Details:      
 
Domain Number 5 Region: 276-404
Classification Level Classification E-value
Superfamily Cadherin-like 3e-26
Family Cadherin 0.00089
Further Details:      
 
Domain Number 6 Region: 70-174
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-26
Family Cadherin 0.00066
Further Details:      
 
Domain Number 7 Region: 1396-1591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-25
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 8 Region: 710-824
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 403-504
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 11-76
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000257
Family Cadherin 0.0042
Further Details:      
 
Domain Number 11 Region: 818-920
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000002
Family Cadherin 0.011
Further Details:      
 
Domain Number 12 Region: 1086-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000745
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 13 Region: 1724-1764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 1595-1628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008929
Domain Number - Region: 1065-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 1635-1671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008929   Gene: ENSECAG00000010573   Transcript: ENSECAT00000011423
Sequence length 2399
Comment pep:known chromosome:EquCab2:28:42247372:42387686:-1 gene:ENSECAG00000010573 transcript:ENSECAT00000011423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRLSYQMEALFDERSNGYFLIDADTGAVSTARALDRETKDTHVLKVSAVDHGSARRSAAT
YLTVTVSDTNDHSPVFEQSEYRERVRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAG
GVFEIDARSGVVRTRAAVDREEAAAYQLLVEANDQGRNPGPLSATATVHIVVEDENDNYP
QFSEKRYVVQVPEDVAVNTPVLRVQATDGDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLD
VINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLEN
VPLGHSVLHIQAVDADAGENARLRYRLVDTASASVGGGSAGLQDPASASDFPFQIHNSSG
WITVCAELDREAVEHYSFGVEAVDHGSPPMSSSASVSITVLDVNDNDPMFTQPVYELRLN
EDAAVGSSVLTLRARDRDANSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQ
YVLAVTASDGTRSHTAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDED
TGENARITYVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLGITARDNGIPQKSDTTS
LEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDG
DGDFYIEPTSGVIRTQRRLDRENVAVYNLRALAVDRGSPAPLSASVDIQVTVLDINDNPP
VFERDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLR
ALVELDFEVRREYVLVVQATSAPLVSRATVHICLLDQNDNPPVLPDFQILFNNYVTNKSN
SFPTGVIGRIPAHDPDLSDSLNYTFLQGNELQLLLLDSATGELQLSRDLDNNRPLEALME
VSVSDGIHSVVALCTLRVTIITDDMLTNSITVRLENMSQEKFLSPLLSLFVEGVATVLST
TKDDVFVFNIQNDTDVSSNILNVTFSALLPGGVRGKFFPSEDLQEQIYLNRTLLTAVSTQ
RVLPFDDNICLREPCENYMKCVSVLKFDSSAPFISSTTVLFRPIHPINGLRCRCPPGFTG
DYCETEIDLCYSSPCGANGRCRSREGGYTCECLEDFTGEHCEVNARSGRCANGVCKNGGT
CVNLLIGGFHCVCPPGGFERPYCEVTTRSFPPQSFVTFRGLRQRFHFTISLTFATQERNA
LLLYNGRFNEKHDFIALEIVDEQVQLTFSAGETTTMVAPQVPGGVSDGRWHSVQVQYYNK
PNIGRLGLPHGPSGEKVAVVTVDDCDTAVAVRFGSLVGNYSCAAQGTQSGSKKSLDLTGP
LLLGGVPNLPEDFPVHNQQFVGCMRNLSIDGRNVDMAAFIANNGTRAGCVAQRNFCDGTW
CQNGGTCVSRWNTYLCECPLRFGGKNCEQVMPHPQRFSGESIVSWSDLDITISVPWYLGL
MFRTRKEDGVLMEATAGMSSRLHLQILNSHIQFEVSHGPSDVASMRLSRSRVTDGEWHHL
LIELKSAKEGKDIKYLAVMTLDYGMDQDTMQIGNQLPGLRESLIVGGSEDKVSVPKGFRG
CMQGVRMGETSTNIAMLNMNDALKVRVKDGCDMENPCASSPCPQHSRCQDSWDGYSCVCD
KGYFGRKCVDVCHLNPCEHVAACVRSPGSPRGYVCECGSSHYGQYCENRIDLPCPKGWWG
NPVCGPCHCAVSKGFDPDCNKTNGQCQCKENYYRPPDQDACLPCDCFPHGSHSRTCDADT
GQCACKPGVIGRQCNRCDNPFAEVTTLGCKVIYSGCPRAFEAGIWWPQTKFGQPAAVPCP
KGSVGNAVRHCSGEKGSLPPELFNCTTVSFVELKAMNEKLSRNETRMDGDGSLRLARALR
NATRHTDVPFGNDVRTAYQLLGRVLQHESGQQGFDLAATRDANFHEDVIHTGSALLAPGT
RAAWEHIQRSEGGAAQLLKHFEAYFRNVARSVRQTYLRPFVIVTANMILAVDVFDTFNFT
GARVPRFQDVREDFPKELESSVVFSADFFKPTERKEGPTVRPVGRKAALQTVRPEPSAER
EAQFRRRKRHPDEPGQFAVALVVIYRTLGQLLPEHYDPDRRSLRLPNRPVINTPVVSAVV
YREGAPLTSPPERPILVEYTLLETEERTKPVCVFWNHSITISGTGGWSAKGCELLSRNRT
HVSCQCSHATSCAVLMDVSRREHGEVLPLKIITYAAVSLSLAALLVAFVLLALVRPLRSN
LHSIHKNLTGALFFSQLVFVIGITQTENPFLCTVIAILLHYVYMSTFAWSFVESLHVYRM
LTEVRNIDAGPMRFYYVVGWGIPAIVTGLAVGLDPQGYGNPDFCWLSLQDTLIWSFAGPI
GTVIIVNTVIFVLSAKVSCQRKHHYYERKGIVSLLRTAFLLLLLISATWLLGLLAVNSD
Download sequence
Identical sequences F7C292
9796.ENSECAP00000008929 ENSECAP00000008929 ENSECAP00000008929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]