SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008982 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008982
Domain Number 1 Region: 408-583
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.15e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 585-685
Classification Level Classification E-value
Superfamily E set domains 1.03e-25
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008982   Gene: ENSECAG00000010992   Transcript: ENSECAT00000011481
Sequence length 901
Comment pep:known chromosome:EquCab2:1:162260068:162268961:1 gene:ENSECAG00000010992 transcript:ENSECAT00000011481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAASCEDEELEFKLVFGEEKEAPPLGAGGSGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGLGGGSGGAGGGRILECPSIRITS
ISPTPEPPATLEDNPDAWVDGSPRDYPPPEGFGGYREAGGQGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWNLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLPSGAEE
AAAPPGGPRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLRGFPSASGPPFGTDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRIFPETGGTTGCTRPPPV
SFLPRPFPSDPYGGRGSPFPLGLPFSPPATFRPPLPSSPPNEGPFPPQSGVHPPPAEGYS
EVGPSYGPGEGAPEQEKSRGGYSSSFRDGVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
Download sequence
Identical sequences F7BWR6
9796.ENSECAP00000008982 ENSECAP00000008982 XP_001489052.2.31192 ENSECAP00000008982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]