SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008993 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008993
Domain Number 1 Region: 40-515
Classification Level Classification E-value
Superfamily Sema domain 1.96e-159
Family Sema domain 0.0000000000000607
Further Details:      
 
Domain Number 2 Region: 1079-1341
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-79
Family Protein kinases, catalytic subunit 0.000000000147
Further Details:      
 
Domain Number 3 Region: 654-728
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000129
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 4 Region: 560-657
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000382
Family E-set domains of sugar-utilizing enzymes 0.079
Further Details:      
 
Domain Number 5 Region: 517-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000133
Family Plexin repeat 0.0000611
Further Details:      
 
Domain Number 6 Region: 739-827
Classification Level Classification E-value
Superfamily E set domains 0.00000000091
Family Other IPT/TIG domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008993   Gene: ENSECAG00000010385   Transcript: ENSECAT00000011493
Sequence length 1381
Comment pep:known chromosome:EquCab2:4:73777298:73887681:1 gene:ENSECAG00000010385 transcript:ENSECAT00000011493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPAVLAPGILVLLFTLVQKSDGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGATNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSRKANLSGGAWKDNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPLNNVADIQSEVYCMYSPQAEEPHQCPDCVVSAL
GTKVLLSEKDRFVTFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLPE
FRDSYPIKYIHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECIL
TEKRRKRSTSEEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFAQSKPDSAEPMNRS
AVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPHHEHCFNRTLLRNSSGCEVRNDEYRTEF
TTALQRVDLFMGQFNQVLLTSISTFIKGNLTIANLGTSEGRFMQVVVSRSGSSTPHVNFH
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCGW
CHDKCVRLEECHNGTWTQEICLPTIYKVFPTSAPLEGGTTLTVCGWDFGFRKNNKLDSKK
TKVLLGNESCTLTLSESTSNTLKCTVGPAMNERFNISITVSNSRGTARYSTFSYVDPIIT
SISPSYGPKTGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTEF
PVKLKIDLANREMNSFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVLRMVINVR
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNPV
FKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSHSEAVLCTVPSDL
LKLNSELNIEWKQAVSSTILGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKRRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEVD
T
Download sequence
Identical sequences Q2QLA9
ENSECAP00000008993 9796.ENSECAP00000008993 ENSECAP00000008993 NP_001107619.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]