SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009084 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009084
Domain Number 1 Region: 330-469
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-42
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 2 Region: 911-1061
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-39
Family C-type lectin domain 0.00043
Further Details:      
 
Domain Number 3 Region: 624-758
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-38
Family C-type lectin domain 0.000000151
Further Details:      
 
Domain Number 4 Region: 768-904
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-38
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 5 Region: 2-133
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.61e-35
Family Cysteine rich domain 0.00000106
Further Details:      
 
Domain Number 6 Region: 1199-1335
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-33
Family C-type lectin domain 0.00024
Further Details:      
 
Domain Number 7 Region: 478-617
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 210-325
Classification Level Classification E-value
Superfamily C-type lectin-like 1.11e-29
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 9 Region: 1070-1196
Classification Level Classification E-value
Superfamily C-type lectin-like 8.1e-29
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 10 Region: 133-191
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-20
Family Fibronectin type II module 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009084   Gene: ENSECAG00000010728   Transcript: ENSECAT00000011602
Sequence length 1435
Comment pep:known chromosome:EquCab2:29:17631062:17719217:-1 gene:ENSECAG00000010728 transcript:ENSECAT00000011602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTRQFLIYNEDHKRCVEALNPSTVQTAVCNQDNEAQKFRWVSESQIMSVALKLCLGVPSK
SDWVPVTLYACDSKSEFQKWECRNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWK
VYGTTDDLCSRGYEAMYTLLGNANGATCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDY
DVDKLFGYCPLKFEGSESLWNNDPLTGISYQINSKSALTWQQARKSCQQQKAELLSITEI
HEQTYLTGLTTSLTSGLWIGLNSLSFNSGWQWSDGGPFRYLNWLPGSPSAEPGKSCVSLN
PGKYAKWENLECVQKLGYICKKGNTTLNSFIIPSETDVPTNCPSQWWPYAGHCYKIHREK
KIQRDALTACRKEGGDLASIHSIEEFDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGT
PVTFTKWLRGEPSHENNRQEDCAVMKGKDGYWADRACEKPLGYICKTKSQAQAPGIVEVD
TGCRKGWKRHGFYCYLIGHTLSTFTEANQTCGNEKAYLTTIEDRYEQAFLTSLVGLRPER
YFWTGLSDVRNKGTFQWTIEEEVQFSHWNSDMPGRKAGCVAMRTGIAGGLWDVLRCEEKA
KFVCKHWAEGVTRPPEPTTTPEPKCPEDWGTTTKTSMCFKLYAKGKHEKKTWFESRDFCR
ALGGDLASINNKEEQQAIWRLITTSGNYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAF
GEPNNYQNVEYCGELKGDPSMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTE
DGWVIYKDYQYYFSKEKETMDKAREFCKKNFADLVSIQSESEKKFLWKYVNKNDAQPAYF
IGLLVSLDKKFVWMDGSKVDYVAWATGEPNFANEDENCVTMYSNSGFWNDINCGYPNAFI
CQRHNSSINATAIPTTPSVPGGCKEGWSFYNNKCFKVFGFVEEERKSWQEARKACTGFGG
NLVSILSEKEQAFLTYQMKDSTFNAWTGLNDINSEHTFLWTDGRGVYYTNWGKGYPGGRR
SSLSYEDADCVVMIGGKSKDAGKWMDDTCDSKRGYICHTPSDPSLPNSPATIPTDGFIKY
GESSYSLMKLKLQWYEAEEYCKLHSSLIASILDPYSNAFVWMQTQTFNEPVWIGLNSNLT
HNEYVWTDKWRVRYTNWAADEPRLKSACVYLDVDGYWKTAYCNESFYLLCKRSDEIPATE
PPQLAGRCPESEHSAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFL
SYRVEPLQSKTNFWIGLFRNVEGKWVWINHNPVSFVNWNTGDPSGERNDCVALHASSGFW
SNIHCSSYKGYICKDQKVIVDAEPTTALITTKADPRKMEPPKPSSNMAGVAVIVVLLIII
GAGLTAYFFYKKRRVHLPQENTFENTLYFNSRSSPGTGDTKDLMGNIEQNEHAVI
Download sequence
Identical sequences F6ZH33
ENSECAP00000009084 9796.ENSECAP00000009084 ENSECAP00000009084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]