SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009107 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009107
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 9.79e-72
Family Integrin A (or I) domain 0.000002
Further Details:      
 
Domain Number 2 Region: 1129-1313
Classification Level Classification E-value
Superfamily Fibronectin type III 4.9e-36
Family Fibronectin type III 0.00000368
Further Details:      
 
Domain Number 3 Region: 1509-1710
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-35
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 991-1108
Classification Level Classification E-value
Superfamily CalX-like 1.57e-19
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 5 Region: 625-709
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-17
Family Integrin beta tail domain 0.004
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000298
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009107
Domain Number - Region: 504-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00204
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 467-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0725
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009107   Gene: ENSECAG00000010178   Transcript: ENSECAT00000011628
Sequence length 1805
Comment pep:known chromosome:EquCab2:11:6286173:6312602:-1 gene:ENSECAG00000010178 transcript:ENSECAT00000011628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPHPSPWTRLLLAALLSVSFPGDMANRCKKAQVKSCTECIRVDKDCAYCTDEMFKERR
CNTQAELLAAGCRLESVVVMERSFEITEATQIDTTLRRSQVSPQAMRVRLRPGEEQLFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVNEFRSKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDEECHLDATGTYTQYK
TQDYPSVPTLVRLLGKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALESPRGLKTEITSKVFQKTKTGSFHIRRGEVGTYYVQLRAIEDVDG
THVCQLPLEDQKGNIHLKPSFSDGLRIDVGVICDVCSCELQKEVRSAHCSFNGDFMCGHC
MCNEGWSGKTCNCSTGSLSDTQPCLREDEDKPCSGRGECQCGRCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGSSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCNQQSLYTDTICEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECSFKVKMVD
KLKKAEEVVEYCSFRDEDDDCTYSYTVEGDGAPGPNSTVLVHRKKDCPPTSFWWLIPLLI
FLLLLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFATRVASTNPTELVPYGLSLRLARLCTENLLKPDTRE
CNQLRQEVEENLNEVYRQITGAYKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKQTLL
KLTEKHVEQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYLVSGGEQVARIPVVRRILDN
GKSQVSYRTQDNTAQGNRDYIPVEGELLFQPGEMWKELQVKLLELQEMDSLLRGRQTRHF
HIQLSNPKFGARLGQPHSATVIIGDPDELDRNLISQTVSSPPPPRGDLGAPQNPNAKAAG
SRKIHFNWLPPPGKPTGYRVKYWIQGDSELEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDSPKKRTLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQSGEDYESFLMYSDDVLRSPAGSQRPSVSDDTEHLVNGRMDF
AYPGSANSLHRMTVANAAYGTHLSPHLPHRVLSTSSTLTRDYHSLTRTEHSHTATLPRDY
STLTSLSSHSLPPIWEHGRSRLPLSWALGSRSRAQMKGFPHSRDSRDSIILAGQPAAPSW
GPGSRLAAGVPNTPTRLVFSALGPTSLKVSWQEPQCDQALQGYSVEYQLLNGGELHRLNI
PNPSQTSVVVEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQSPLCPLPGSTFT
LSTPSAPGPLVFTALSPDSLQLSWERPRRPDGDILGYLVTCEMAHGGEPATTFLVDGDSP
ESRLTVPGLSENVPYKFKVQAKTTQGFGPEREGIITIESQDGGPFPQLGSHSGLFQHPLP
GEYSSITTTHTSTIEPFLLDGLTLGSQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTQVDQ
QFFQT
Download sequence
Identical sequences F7BIL4
XP_014594069.1.31192 ENSECAP00000009107 ENSECAP00000009107 9796.ENSECAP00000009107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]