SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009190 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009190
Domain Number 1 Region: 483-737
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-49
Family YWTD domain 0.00000427
Further Details:      
 
Domain Number 2 Region: 46-304
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-36
Family YWTD domain 0.0000765
Further Details:      
 
Domain Number 3 Region: 401-476,733-782
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000108
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 973-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000359
Family EGF-type module 0.0009
Further Details:      
 
Domain Number 5 Region: 744-781,837-926
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000816
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 349-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000339
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 909-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000198
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 312-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009190   Gene: ENSECAG00000010741   Transcript: ENSECAT00000011719
Sequence length 1211
Comment pep:known chromosome:EquCab2:2:115782999:115863078:-1 gene:ENSECAG00000010741 transcript:ENSECAT00000011719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLSTLLPAVFAAAFVSVSARPRWDCPAGPPSGKGHSPCVGPVPFLIFSYGNSIFRID
LEGTNHEQLVTDAGISVIMDFHYNKGRIYWVDLARQLLQSVLLNGTRQERICNIERNVSG
MAINWINEELIWSNQEEGVITVTDMKGNNSRVLLGTLKSPANVAVDPVERLLFWSSEAAG
SLHRADLNGVEEKVLLETSGKITAVSLDVLEKRLFWIQYDREGDNSRVCSSDYDGGSVRC
CKHLTQHNLVAVSLFGDRIFYSTWRKQTIEIADKYTGKDVVRINLSRSFAPPAGIKAVHP
LMQPEADGGAQASDQKVCKLRKSDCRGSVCGQDPKSHLCACVEGYTLSQDGKSCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHELISCPSNASECSHDCVLTSDGPL
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCIPLSPASWECSCFPGYDLQLDQKSCAASG
PQPFLLFANSKDIRHMRFDGTDYGILLSQQMGAVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLVEEAVDVPEGLAVDWIGRKLYWTDRGKALIEGSDLNGKFREIIVREDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGTGRLVIVSSDLAWPSGITIDYLTDKLYWCD
AKKSVIEMADLDGSKRRRLAQNDVGHPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVIVHPLAKPGADPCSHQNGGCEHTCKERFGTAQCLCREGFMKAPDGKMC
LALNGHQILAGSEADLSGQTTPLGILSRSRGCEDNISESQQMLVAEIMVSVSSNDDDCGP
VRCGPHAQCVSEGEEAICQCFKGFAGDGQLCSDVDECEVGNLVCPHPSSRCVNTEGGYVC
QCSEGYRGDGMHCLDIDECQLGMHTCGENASCTNTEGNYTCLCAGGLSGPGWICPNSTVP
SPPREDGHYSVRNSYQECSQSYDGYCLHGGKCVYLVQVDTHACNCVVGYVGERCQHQDLR
WWELRHTGHGWPRSITVVAVCMVVLILLLLLGLWGAHYHRAQKLLLKNPKNPYEESSRDM
SGNRPADSEAGMSSCPQPWFVVIKEQQQNLRSGDQPVHPKDGETADVGQFSSLEPGSLQQ
TSWRKEPQRYTGTEQGCCIPPSSGKGSGPQAMECSFHLPSYGARPAATGVEKPHSLLSAN
PLWQQRAPDPP
Download sequence
Identical sequences F7B762
9796.ENSECAP00000009190 ENSECAP00000009190 ENSECAP00000009190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]