SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009233 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009233
Domain Number 1 Region: 244-490
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.03e-89
Family Eukaryotic proteases 0.0000319
Further Details:      
 
Domain Number 2 Region: 155-251
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-19
Family Hepsin, N-terminal domain 0.04
Further Details:      
 
Domain Number 3 Region: 134-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000602
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009233   Gene: ENSECAG00000011308   Transcript: ENSECAT00000011769
Sequence length 498
Comment pep:known chromosome:EquCab2:7:25832965:25849135:-1 gene:ENSECAG00000011308 transcript:ENSECAT00000011769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPARTSPAQASPARGSPAHASPARASPSRSSSGRSSSAGSPSTTSSPTRACLVKATPVGA
VPVRASPARSAPAARATGENPGISFHKFTWQEGQKRLPLIGCILLLIVLVASLILLFYFW
RGHTGIKYKEPEESCPKHSVRCDGVVDCKLKSDELGCVRFDWDKSLLKVYSGSSHRWLPV
CSDSWNDSYSTKTCRQLGFESAYWTTEVGHRDFASSFSVSKYNSTIQESLYRSECPSQRY
VSLQCAHCGLRAMTGRIVGGALAPESKWPWQVSLHYGTTHVCGGTLIDAQWVLTAAHCFF
VTREKILEGWKVYVGTNNLHQLPEAASISQIIINGNYTDEQDDYDIALMRLSKPLTLSAH
VHPACLPMHGQTFSLNETCWITGFGKTKETDEKTSPFLREVQVGLIDFKKCNDYLIYDSY
LTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTE
VLPWIYSKMENEVRFRKS
Download sequence
Identical sequences F7ALK1
ENSECAP00000009233 9796.ENSECAP00000009233 ENSECAP00000009233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]