SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009252 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009252
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000905
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009252   Gene: ENSECAG00000011315   Transcript: ENSECAT00000011793
Sequence length 339
Comment pep:known chromosome:EquCab2:7:44458923:44496867:1 gene:ENSECAG00000011315 transcript:ENSECAT00000011793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDECEPPYSRYCGANAKCRNVIGSFDCHCDSGYELLSGGTRFNNSNENTCQTTTTAATT
TYRKEVQQIVDKVESLLSNKTLWEEKRDVPSWATNILQETESNVLKTALKTPNQNNQRGQ
TSTVAVETRVVTDNCSEERKVFTLNAQKNSVDILCADVVQGNIQGPSAVAFVSYSSLGNI
INATFFEEKNETHQIRLNSHVVSAGIGPKRNISLSNPLTLSFQHVEVGPSINKVFCVYWE
TTKGRWSTDGCFLNKVNESHTICNSTHLSSFAVLMAVSSQEEDPVLDVITYVGLSLSLLC
LLLAALTFLLCRAIQNTSTSLHLQLSLCLFLAHLLFLTA
Download sequence
Identical sequences F7AKS7
ENSECAP00000009252 9796.ENSECAP00000009252 ENSECAP00000009252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]