SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009353 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009353
Domain Number 1 Region: 224-413
Classification Level Classification E-value
Superfamily vWA-like 1.21e-55
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 427-589
Classification Level Classification E-value
Superfamily vWA-like 2.74e-43
Family Integrin A (or I) domain 0.00088
Further Details:      
 
Domain Number 3 Region: 19-212
Classification Level Classification E-value
Superfamily vWA-like 2.74e-39
Family Integrin A (or I) domain 0.00092
Further Details:      
 
Domain Number 4 Region: 623-757
Classification Level Classification E-value
Superfamily vWA-like 9.05e-32
Family Integrin A (or I) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009353   Gene: ENSECAG00000011557   Transcript: ENSECAT00000011911
Sequence length 760
Comment pep:known chromosome:EquCab2:16:66256406:66269579:1 gene:ENSECAG00000011557 transcript:ENSECAT00000011911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METWTTFWGLIFLATNFGFIKSQRIACREASMGDVVCLVDANVNPQHTRSMRNFLYTLVN
GFNVSRETIRVALAQYSDVPHSEFLLSHHRKGNVLRHIQKVQFKPGGNKLGLALQFLLDD
HFQETAGSRASQGVPQVAVVISSGPAEDHVREPAEAFRRAGVLLYAVGLRKGALAELREI
ASSPVEKFTSFVPNFSGLDSLAQKLQQELCDILAKAAQPADHASPACREAVLADIVFLVD
SSTSIGPQNFQKVKNFLRSVVLGLDIGSDQVQVGLAQYYDNIYPAFQLNQYPLKSVVLEQ
IQNLPYRTGGTNTGSALEFIRTNYLTEAAGSRAKDRVPQIVILVTDGESNDEVQEAADRL
KEDGVLVYVVGVNVQDIQELQKIASKPFEKFLFSTENFNILQDFSGSILQTLCLAVEGEI
KESIQAYADVVFLADTSRNTSWTSFQWMQNFISRVVGMLDVGRDKYQIGLAQYGDQGHTE
FLFNTYQTKDEMIAHIHEHFVLRGGSRRTGKALRYLHQTFFQEAAGSRFLQGIPQYAVVI
TSGKSEDEVQDAAQTLREKGVKVMSVGVQDFDRRELEGMGTPPLIYEMQGQDGVRQMIHN
VNAVIQGTGQPEFSTQAEKEAAVVCPVAIPADLVFLIEEFSRAGRSNFQQVVNFLKTTIS
SLSIHPDAVRTGLVFYSEEPQLEFSLDTFQNSAKVLERLDKLTYQGQRGRIKTGAALDFL
RNEVFIQEKGSRSKQGVQQIAVVITDGFSQDNVSRPASLL
Download sequence
Identical sequences F6ZS44
9796.ENSECAP00000009353 ENSECAP00000009353 ENSECAP00000009353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]