SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009385 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009385
Domain Number 1 Region: 80-238
Classification Level Classification E-value
Superfamily E set domains 1.68e-54
Family RhoGDI-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009385   Gene: ENSECAG00000011487   Transcript: ENSECAT00000011949
Sequence length 242
Comment pep:known chromosome:EquCab2:11:42501435:42506987:-1 gene:ENSECAG00000011487 transcript:ENSECAT00000011949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKKGGGGAGTGAEPTPGASGPSVEPKLEPQPQVESESGSESEPEAGPGPRPGPLQRKQ
PIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPASERLPINR
RDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFH
FGFCIPSSKNTCEHIYDFPPLSEELINEMIHHPYETQSDSFYFVDDRLVMHNKADYSYSG
TP
Download sequence
Identical sequences F6ZL53
9796.ENSECAP00000009385 XP_001504190.1.31192 ENSECAP00000009385 ENSECAP00000009385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]