SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009429 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009429
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1044-1157
Classification Level Classification E-value
Superfamily E set domains 3.07e-37
Family Filamin repeat (rod domain) 0.00000502
Further Details:      
 
Domain Number 3 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 2.74e-36
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 4 Region: 1533-1641
Classification Level Classification E-value
Superfamily E set domains 8.67e-33
Family Filamin repeat (rod domain) 0.0000065
Further Details:      
 
Domain Number 5 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 1.8e-32
Family Filamin repeat (rod domain) 0.00048
Further Details:      
 
Domain Number 6 Region: 1427-1543
Classification Level Classification E-value
Superfamily E set domains 2.07e-32
Family Filamin repeat (rod domain) 0.0000353
Further Details:      
 
Domain Number 7 Region: 1859-1954
Classification Level Classification E-value
Superfamily E set domains 4.94e-31
Family Filamin repeat (rod domain) 0.00000376
Further Details:      
 
Domain Number 8 Region: 671-779
Classification Level Classification E-value
Superfamily E set domains 3.69e-30
Family Filamin repeat (rod domain) 0.00031
Further Details:      
 
Domain Number 9 Region: 2035-2137
Classification Level Classification E-value
Superfamily E set domains 9.75e-30
Family Filamin repeat (rod domain) 0.0000191
Further Details:      
 
Domain Number 10 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 2.61e-29
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 11 Region: 1147-1251
Classification Level Classification E-value
Superfamily E set domains 5.54e-29
Family Filamin repeat (rod domain) 0.0000887
Further Details:      
 
Domain Number 12 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 8.67e-29
Family Filamin repeat (rod domain) 0.000013
Further Details:      
 
Domain Number 13 Region: 2232-2327
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 14 Region: 2426-2518
Classification Level Classification E-value
Superfamily E set domains 3.6e-26
Family Filamin repeat (rod domain) 0.00000984
Further Details:      
 
Domain Number 15 Region: 380-479
Classification Level Classification E-value
Superfamily E set domains 7.01e-26
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 16 Region: 279-375
Classification Level Classification E-value
Superfamily E set domains 4.47e-25
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 17 Region: 2554-2645
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0000185
Further Details:      
 
Domain Number 18 Region: 2329-2423
Classification Level Classification E-value
Superfamily E set domains 3.14e-24
Family Filamin repeat (rod domain) 0.0000116
Further Details:      
 
Domain Number 19 Region: 564-665
Classification Level Classification E-value
Superfamily E set domains 5.54e-24
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 20 Region: 768-870
Classification Level Classification E-value
Superfamily E set domains 1.33e-23
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 21 Region: 1630-1740
Classification Level Classification E-value
Superfamily E set domains 2.6e-23
Family Filamin repeat (rod domain) 0.0000934
Further Details:      
 
Domain Number 22 Region: 2155-2249
Classification Level Classification E-value
Superfamily E set domains 3.6e-21
Family Filamin repeat (rod domain) 0.0000115
Further Details:      
 
Domain Number 23 Region: 958-1064
Classification Level Classification E-value
Superfamily E set domains 1.6e-20
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 24 Region: 1960-2057
Classification Level Classification E-value
Superfamily E set domains 2.29e-18
Family Filamin repeat (rod domain) 0.0000867
Further Details:      
 
Domain Number 25 Region: 1796-1874
Classification Level Classification E-value
Superfamily E set domains 4.27e-17
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009429   Gene: ENSECAG00000009550   Transcript: ENSECAT00000011995
Sequence length 2646
Comment pep:known chromosome:EquCab2:X:122645068:122667533:-1 gene:ENSECAG00000009550 transcript:ENSECAT00000011995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRAGQSAAGAALGAGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVMI
QDPAGQKGTVEPQLEARGDSTYRCSYQPTMEGIHMVHVTFAGVPIPRSPYAVTVGQACNP
GACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ASVKDNGNGTYSCSYVPRKPVKHTAVVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTIKSKGAGGQGKVASKIVGPSGTPVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGIQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDLTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTAL
AGDQPTAQPPLRPQQLAPPYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKK
GEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD
YVNCGHVTAYGPGLTHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCS
VSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINVSETDLS
LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVANSPIPVVISQ
SEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGT
CRVTYCPTEPGNYIINIKFADQHVPGDPFSVKVTGEGRVKESITRRRRAPSVANVGSHCD
LSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHV
PGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKA
EISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQ
ESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYL
IDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGA
LSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRL
VSNHSLHETSSVFVDSLTKTASVPQHGAPGPGPTDASKVLAKGLGLSKAYVGQKSSFTVD
CSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSP
YRVVVP
Download sequence
Identical sequences F7BH02
ENSECAP00000009429 ENSECAP00000009429 9796.ENSECAP00000009429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]