SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009435 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009435
Domain Number 1 Region: 158-347
Classification Level Classification E-value
Superfamily vWA-like 1.15e-53
Family Integrin A (or I) domain 0.00064
Further Details:      
 
Domain Number 2 Region: 1-165
Classification Level Classification E-value
Superfamily vWA-like 7.27e-40
Family Integrin A (or I) domain 0.00092
Further Details:      
 
Domain Number 3 Region: 874-1069
Classification Level Classification E-value
Superfamily vWA-like 8.9e-29
Family Integrin A (or I) domain 0.0052
Further Details:      
 
Domain Number 4 Region: 1120-1332
Classification Level Classification E-value
Superfamily vWA-like 5.19e-22
Family Integrin A (or I) domain 0.014
Further Details:      
 
Domain Number 5 Region: 350-546
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000356
Family Integrin A (or I) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009435   Gene: ENSECAG00000011581   Transcript: ENSECAT00000012001
Sequence length 1353
Comment pep:known chromosome:EquCab2:16:66273289:66342820:1 gene:ENSECAG00000011581 transcript:ENSECAT00000012001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SINQEDFLEMKAFMKGVINEFHIGPDRVRFGVVQYSDGINSQIILSQYSTAARMKVAIDG
IQQRGGGTMTGRALSNMARVFADTARSNVPWYLLVITDGKSADPVAEAADALRGDGVIIY
AIGVRDANTIQLKEIAKDKMFFVHEFDSLKSIQQEVVRDVCSSETCKKRKADIIFLIDGS
ESISPKDFEKMKGFMKRMVSQSNIGADEIQIGLLQFSSSPQEEFRLNQYFSNVDIQRAIE
NVQQIYHGTYTGKALDFTLPFFDSSRGGRPSVPQYLIVITDGVARDDVAVPAKALRDRNV
IIFAIGVGEAKNSQLLEITNDQDKVYYEEKFESLQNLEKEILYKVCTPQGCNVELSVGID
ISSPTRQVQQKLQRLLPQLMQQLALLSNISCSVPGQFNTMFRYLVPGPNGQLIFDSGFEK
YNDEIIQKFLVHQAAKSSHLDVDFLQSLGDNSIRLSSAKVKVLLVFTDGLDDDLERLKKT
SELLRSKGFSGLLIIGLEGVHRLEELQELEFGRGFAYNQPLSVKLRSLSSILVKQLNTIV
ERTCCNMCVKCFGEDGHRGDGGSPGRKGEKGSDGLPGYPGEEGGRGERGPQGLPGLRGEE
GCRGIKGPKGARGFSGEKGNLGDDGVDGLDGERGNRGVPGSSGEKGNRGNRGLTGPPGRP
GEHGQPGLRGDPGDPGIDNYIQGPKGEKGRHGHQGSSSFSGPQGEAGNVGPQGSRGRRGQ
PGLKGVHGESGEQGYPGELGYPGPQGPRGRQGVPGTFGQKGSQGAQGNPGPPGPNGSKGK
AGPRGMKGELGDEGERGPRGQQGPRGQPGLFGPDGYGRPGRKGTKGEPGFPGYPGVQGED
GDPGHRGEKGAKGIRGKRGNAGFPGFVGIPGDRGPPGPRGIKGPKGLVDMTPCEIINFMQ
ENCPCSTGISKCPAFPTEVVFALDMSNDVSQLDFERMRDILLSLLMKMEISESNCPTGAR
VSIVSYNTKTDYLIRFSDYKRKPALLQAVRKIPLEVSSGSRKLGDAMRFVARHVFKRARS
GLLTRNVAVFFQAGWARDTDSISTATLELSALDIIPAVIAFTEEHNLPDALLMDGANRFH
LFVWETKGQQDVGHVARCTLCYDKCRPAPECRLGTSGPLAVDVDVAFVVDSSHGVGADEY
RAALRLVDAVLDDLEVAVQPSTSPSGARAALVMHTTPGFLPGAGRPPVLEGFHLTSYGHR
TQMQRHVREALGRPLNGAPALGHALEWTLEKVLLAAPVPRRARVLFAIVASETSSWDREK
LKTLSLEAKCKGITLFVLALGPGVGTRELADLFHVASLPSEQHLLRLEGISDPEVTYARR
FTRAFLNLLKRGTNQYPPPELTEECGGPKRGDT
Download sequence
Identical sequences F7BGN8
ENSECAP00000009435 ENSECAP00000009435 9796.ENSECAP00000009435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]