SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009449 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009449
Domain Number 1 Region: 599-876
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.34e-79
Family Protein kinases, catalytic subunit 0.00000000064
Further Details:      
 
Domain Number 2 Region: 8-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-61
Family Ephrin receptor ligand binding domain 0.00000000983
Further Details:      
 
Domain Number 3 Region: 312-517
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-32
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 4 Region: 895-964
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 241-310,351-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000196
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009449   Gene: ENSECAG00000010632   Transcript: ENSECAT00000012016
Sequence length 977
Comment pep:known chromosome:EquCab2:13:8761013:8775098:-1 gene:ENSECAG00000010632 transcript:ENSECAT00000012016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVCLSVLETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGLA
HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYFESDADTATALTPAW
MENPYIKVDTVAAEHLTRKRPGAEATGKVNIKTLRLGPLTKAGFYLAFQDQGACMALLSL
HLFYKKCPQLTVNLTRFPDTVPRELVVPVAGSCVADAVPAPGPSPSLYCREDGQWAEQPV
TGCSCAPGFEAAEGNTRCRACAQGTFKPLSGEGSCQPCPANSHSNSIGSSVCQCRIGYFR
ARTDPRGAPCTTPPSAPRSVVPRLNGSSLRLEWSAPLESGGREDLTYALRCRECRPGGSC
TPCGGDLTFDPGPRDLVEPWVAIRGLRPDFTYTFEVTALNGVSSLATGPVPFEAVNVTTD
REVPPPVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN
RAELQGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDENESWREQLALIAGTAVVGVV
LVLVVIVIAVLCLRKQSSGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEI
DVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQ
FEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRY
LAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPE
AIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLH
QLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKS
QAKPGAPGGSGAPAPQY
Download sequence
Identical sequences F7BG55
ENSECAP00000009449 ENSECAP00000009449 9796.ENSECAP00000009449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]