SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009453 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009453
Domain Number 1 Region: 18-309
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-89
Family Amylase, catalytic domain 0.000000000427
Further Details:      
 
Domain Number 2 Region: 310-403
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.44e-26
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009453   Gene: ENSECAG00000011376   Transcript: ENSECAT00000012021
Sequence length 411
Comment pep:known chromosome:EquCab2:28:38422783:38430174:-1 gene:ENSECAG00000011376 transcript:ENSECAT00000012021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKTVLLLALVDHVLLLENGLLQKPPMGWLAWERFRCNTDCDEDPKNCISERLFMEMAD
RLAQDGWRDLGYTYLNIDDCWIGGRDAKGRLVPDPKRFPNGIDFLADYAHSLGLKLGIYS
DLGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAKGYPKMAAALNATG
RPIAFSCSWPAYEGGLPPQVNYSLLADICNLWRNYDDIQDSWRSVLSILNWFVEHQDILQ
PVAGPGHWNDPDMLLVGNYGLSFEQAQSQMALWTVLAAPLFMSTDLRTISAQNMDILQNP
LMIKINQDPLGIQGRRILMDKSYIEVFMRPLANEASALVFFSRRTDMPYHYHSSLAQLNF
TGSNVYEAQNVYTGDIISGLRAETNFTVVINPSGVVMWYLYPVRKLGMPQQ
Download sequence
Identical sequences F7BFV9
9796.ENSECAP00000009453 ENSECAP00000009453 ENSECAP00000009453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]