SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009499 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000009499
Domain Number - Region: 110-151
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.017
Family FolH catalytic domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009499   Gene: ENSECAG00000011675   Transcript: ENSECAT00000012067
Sequence length 222
Comment pep:known chromosome:EquCab2:25:35699389:35708741:-1 gene:ENSECAG00000011675 transcript:ENSECAT00000012067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLMAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTMFFVAVNRAHSGPGIAAGTW
GRLDPLRNWIPRGFSLHLWICLTSPLADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYS
GPIGTAVLIIAAKWLQQMKEKKGLYPDRSVYTQQIGPGLCFGALALMLHFFFEDWDYTYV
HSFYHCALAMSFILLLPKVNKKAGSAGPPAKLDCSTLCCACI
Download sequence
Identical sequences F7B9H9
ENSECAP00000009499 9796.ENSECAP00000009499 ENSECAP00000009499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]