SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009602 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009602
Domain Number 1 Region: 14-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.12e-33
Family Laminin G-like module 0.00077
Further Details:      
 
Domain Number 2 Region: 192-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009602   Gene: ENSECAG00000011798   Transcript: ENSECAT00000012181
Sequence length 259
Comment pep:known chromosome:EquCab2:Un2904:4568:6234:-1 gene:ENSECAG00000011798 transcript:ENSECAT00000012181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STVSERENSRPFLADFHGFSYLELKGLHTFDRDLGEKMALEVVFLARSPSGLLLYNGQKT
DGKGDFVSLALHDHRLEFRYDLGKGAAVIRSKEPVALGTWTRVSLERSGRKGAMRVDDGP
RVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLKGQQLLTQEHV
VRAVDVSSFADHPCTRASGYPCLNGASCLPREASYVCLCPGGFSGLHCEKGLIEKSAGDL
DTLAFDGRTYIEYLNAVTE
Download sequence
Identical sequences H9GZW9
ENSECAP00000009602 ENSECAP00000009602 9796.ENSECAP00000009602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]