SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 69_2 > ENSECAP00000009607

Domain assignment for ENSECAP00000009607 from Equus caballus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000009607
Domain Number 1	Region: 2-187
Classification Level	Classification	E-value
Superfamily	YWTD domain	1.15e-28
Family	YWTD domain	0.00017
Further Details:

Domain Number 2	Region: 278-319
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000249
Family	LDL receptor-like module	0.0018
Further Details:

Domain Number 3	Region: 319-358
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000038
Family	LDL receptor-like module	0.0013
Further Details:

Domain Number 4	Region: 413-449
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000602
Family	LDL receptor-like module	0.0011
Further Details:

Domain Number 5	Region: 373-408
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000209
Family	LDL receptor-like module	0.0013
Further Details:

Domain Number 6	Region: 243-280
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000209
Family	LDL receptor-like module	0.0017
Further Details:

Weak hits

Sequence:	ENSECAP00000009607
Domain Number -	Region: 197-258
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0251
Family	EGF-type module	0.013
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000009607 Gene: ENSECAG00000011793 Transcript: ENSECAT00000012187
Sequence length	449
Comment	pep:known chromosome:EquCab2:18:23783227:23855111:-1 gene:ENSECAG00000011793 transcript:ENSECAT00000012187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VGSVEGLAYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVIAMSEDDHPHVLALDE CQNLMFWTNWNEQHPSIMRATLTGKNAQMVVSTDILTPNGLTIDHRAEKLYFSDGSLGKI ERCEYDGSQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIP HQPMGIIAVANDTNSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVAKN SSCNIYSEFECGNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNHRCIPH DKLCDGENDCGDNSDELDCKVSTCAAVEFRCADGTCIPRSARCNQNIDCADASDEKNCNN TDCTHFYKLGVKTTGFIKCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYF GCPSGRCILNTWICDGQKDCEDGLDEFHC
Download sequence
Identical sequences	F7A1R3 9796.ENSECAP00000009607 ENSECAP00000009607 ENSECAP00000009607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]