SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009646 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009646
Domain Number 1 Region: 1091-1219
Classification Level Classification E-value
Superfamily TNF-like 5.8e-26
Family TNF-like 0.0018
Further Details:      
 
Domain Number 2 Region: 1033-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000917
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009646   Gene: ENSECAG00000011719   Transcript: ENSECAT00000012231
Sequence length 1220
Comment pep:known chromosome:EquCab2:3:48116712:48184435:-1 gene:ENSECAG00000011719 transcript:ENSECAT00000012231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGARLFVLLSSLWSGGLGLTNTTHTWTIPEDGNPQKNMTTASVPLNEIQSLQMLPTAQT
GSAERAATPEARSSEESLLKSALLPMETSASPEGVRNQTLTPTEETAEGPLKSQTPALLP
KSSIQFSPRAASAVLPDSTLKFLQSFAKNLNQQASPLNSAGGVGNRSPRETYLSRGDNSG
GQRTNSQKSSFETTRGKNWCAYVHTRLSPTVILDNQVTYVPSGRGPCGWNSGSCPQRSQQ
ISNPVYRMQHKIVTSLEWKCCPGFSGEKCQPKAQEQQDLIHSNQAESHTAVGRRTAEQQQ
QQQQQDCGDPAVTQKMADQLNHQAMKLTVLQTKIDNVSLAVSDVKNACSSLEGKINEDKG
REFQSFLKGLKSKSINDLIKDIVREQFKAFKKDMHETVAQVFKTVSSLSEDLENTRQIIR
QVNESVVSIAVQQKSVLMQENRPTSTDILDLKNRITNIRQEMIFTCEKPIKELEAKQTHL
EGALEQEHSRSILHYESFNKTLSKMKEVQEQLLSTEQISDQKSVSAADSVSDNVTEYMST
LHENIKKQGVMMLQMFDDLHIQESKITNLTIALEMEKRSVRGECEDMLSKCRKDFKFQIK
DTEESLQVLNQTLAEVLFPMDNKMNKMNEQLSDLTYDMEILQPLLERGGSFRETMTYEQQ
KEAAATSKKVENMISVVNGLNILIKELSKRHNLLRNEVQSRGDALDRRINEYALEMEDGL
NKTMTIINNAIDFIQDNYMLKETLSTIKYNPEVHHKCTQNMETILTFIPQFQRLNDSIQI
LVNDDQRYNFVLQVAKVLADISKDEKLNQSNFQKISQMFNESTSQVIKYQQNMSHLEEKI
LSATKISKNFEIRLQDIETKVTKMLTPYYISLKKGSVATNERDQALQLQVLNSRFKALEA
KSIHLSINFSLLNKTLYEALTMSHNASASISELKATIPKWIKGSVPDIELLQKDLTEFVE
SVIEIKTQIALSNLTRYINRSLSGSLANVVKSQKQVKPLLKKANTLKKPTVNLTTVLTGR
AQRNTDNVVFPEEYSDCSRFPCQNGGTCINGRTSFVCACRHPFTGDNCTVKTVEENALAP
DFSKGSYRYAPMVAFFASHTYGMTTPGPILFNNLDLNYGASYTPRTGKFRVPYLGVYVFK
YTIESFSAHTSGFLVVDGKDKLAFESENINSEIHCDRVLTGDALLELNYGQEVWLRLVKG
TIPAKYPPATTFSGYLLYRT
Download sequence
Identical sequences F6ZWK7
ENSECAP00000009646 ENSECAP00000009646 9796.ENSECAP00000009646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]