SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009695 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009695
Domain Number 1 Region: 283-470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-66
Family SPRY domain 0.00000739
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily RING/U-box 1.91e-21
Family RING finger domain, C3HC4 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009695   Gene: ENSECAG00000011880   Transcript: ENSECAT00000012286
Sequence length 474
Comment pep:known chromosome:EquCab2:27:22586694:22592050:-1 gene:ENSECAG00000011880 transcript:ENSECAT00000012286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYEKTSTADLMENLREELTCFICLDYFTNPVTTECGHSFCLMCLLKSWEEYNTTLSCP
ECWRTLETPHFQPNERLGRLAGIGKQLRSQVLQSEDDQGSYGKMLAAAKVFSVEKQGVNA
SSTHCHGINRVYVSSEAEEHHREKLQEILTLLRKKKKETQIILTHEKERVILCTEETKTC
KQVVVSEYVKMHQFLKEEEHLQLQLLEKEERGNMKKLRDNEIQLTQQLRSLSKMIQRIES
VCQNPIIESFEDVRGTLERSEPLLLQCPEAAITELSLCRITGMREMLRKFSTDITLDPDT
ANAYLVLSEDLKSVRHGGTRQLLPDNPERFDKSATVLGAQIFTCGRHYWEVEVGNKTEWE
VGICKDSVSRKGNLPKPAGDLFSLIGLKIGDDYSLWVSSPLKGQHIREPVHKVGVFLDYE
SGHIAFYNVMDESLIYSFPSASFQEALRPIFSPCLPNEGTNTGPLTICSLNSHV
Download sequence
Identical sequences F6ZKC2
ENSECAP00000009695 XP_001489779.1.31192 ENSECAP00000009695 9796.ENSECAP00000009695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]