SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009799 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009799
Domain Number 1 Region: 29-113
Classification Level Classification E-value
Superfamily E set domains 0.000000000168
Family Filamin repeat (rod domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009799   Gene: ENSECAG00000011963   Transcript: ENSECAT00000012406
Sequence length 480
Comment pep:known chromosome:EquCab2:7:22839080:22847771:-1 gene:ENSECAG00000011963 transcript:ENSECAT00000012406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETELKIKRIKEKLDQLIPPRPFTHVNTTTSAAHSRVTILNPQDTYCRGDQLDILVEVRDH
LGRRKEYGGDFLRARMSSPALKAGASGKVTDFNNGTYLVSFTLFWEGQVSLSLLLIHPSE
GVSALWRARNQGYDRVIFKGKFVNGTSQVFTECGLTPISSAELCEYLETRDQEAFYCVRP
QHMPCEALTHMTTKNREISYLTVKEKSLFNRSNVGVEMMKHLEHIHVSQCYQRENIKEKC
QIGMKVPVPGGYTFEGRWITTFCNQTQFNTIKIKDCLKGKLIYLLGDSTLRQWIYYLPKV
VKTLKFFDLHGTGLFKKHLLLDAERHTQIQWKKHSYPFVTMQLYSVIEEGYIPREIDRIP
GDKNTAISITLGQHFRLFPIDIFIRRAINVRKAIERLFLRSPATKVILKTENIREMHSNT
ESFGDFHGYIQYLTMKDIFKDLNVGVIDAWDMTIAYGTNNVHPPDHVIGNQINMFLNYIC
Download sequence
Identical sequences F6U2M3
ENSECAP00000009799 9796.ENSECAP00000009799 ENSECAP00000009799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]