SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009822 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009822
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000275
Family SAP domain 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009822
Domain Number - Region: 26-106
Classification Level Classification E-value
Superfamily Saposin 0.0654
Family NKL-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009822   Gene: ENSECAG00000011938   Transcript: ENSECAT00000012434
Sequence length 179
Comment pep:known chromosome:EquCab2:16:36172122:36175658:-1 gene:ENSECAG00000011938 transcript:ENSECAT00000012434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWATHGLAVAVALSVLPGSRSLRPGDCEVCISYLGRFYQDLKNRDVTFSPASVEKELTKF
CREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDK
QIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASSRTDL
Download sequence
Identical sequences F6U999
ENSECAP00000009822 9796.ENSECAP00000009822 ENSECAP00000009822 NP_001184244.1.31192 XP_005600540.1.31192 XP_008534166.1.77740 XP_014696029.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]